PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G17290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 294aa    MW: 32457 Da    PI: 10.1332
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G17290.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.63.4e-292677253
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                     prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ +
  OGLUM10G17290.1 26 PRLRWTPDLHHCFVHAIHKLGGQHKATPKRVLQLMGVGGLTISHVKSHLQAF 77
                     8*************************************************87 PP

2Myb_DNA-binding48.22.5e-152775145
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwq 45
                     r+rWT++++  +v+a+++lGg    t+k++ + mg  g+t  ++ks++q
  OGLUM10G17290.1 27 RLRWTPDLHHCFVHAIHKLGGQhkaTPKRVLQLMGvGGLTISHVKSHLQ 75
                     89**********************************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    
MAMVRGTMVR RERIEGVRQY NRSKVPRLRW TPDLHHCFVH AIHKLGGQHK ATPKRVLQLM  60
GVGGLTISHV KSHLQAFSRW MIRSKHLQEA CKFGQICSCR IIIMSAMDPI ADATPHQNMQ  120
RAHCCCYTTT SSSNSCKGQM RWRRDEQRRA PKQAFSEAKE YVRGTCPPAS LSQLPTTRPW  180
RTAHHLPPQT EHKATPPPEN GAIRHGRKAR RTTAAAEEEE RDGDGDELSL SLTLDSGLSC  240
RSSAGAGAYC CSEGSSSNWL ISSPSSTTSP VAGGCSRRST PAMLSSVVSL DLSL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-27G2-like family protein