PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G22410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 257aa    MW: 28529.1 Da    PI: 6.9705
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G22410.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81.1e-324599155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  OGLUM05G22410.1 45 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 99
                     79****************************************************8 PP

2Myb_DNA-binding52.31.3e-164798148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT +++ ++vda++qlGg+   t+k +   mg  g t +++ks++qky+
  OGLUM05G22410.1 47 RLRWTSDLHNRFVDAIAQLGGPdraTPKGVLTVMGvPGITIYHVKSHLQKYR 98
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    
MMYHAKKFSV PFGPQSTQSN EHMSNIGAFG GSNMGSPANP AGSGKQRLRW TSDLHNRFVD  60
AIAQLGGPDR ATPKGVLTVM GVPGITIYHV KSHLQKYRLA KYIPESPAEG SKDEKKDSSD  120
SLSNTDSAPG MQINEALKMQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQM IIEEQQKLGG  180
SLKACEEQKL PHSPPSLDDY PDSMQPSPKK PKMDNLSPDS VRDVTQSDFE SHLIGPWDQE  240
AAFRVDEFKA DPGLNKS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.19e-56G2-like family protein