PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G29720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 288aa    MW: 31390.5 Da    PI: 8.9696
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G29720.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333185155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  OGLUM02G29720.1 31 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 85
                     79****************************************************8 PP

2Myb_DNA-binding69.74.9e-223384148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48
                     r+rWT++++e++v+av++lGg+   t+k++ r mg kg+tl+++ks++qky+
  OGLUM02G29720.1 33 RLRWTPDLHERFVEAVTKLGGPdkaTPKSVLRLMGmKGLTLYHLKSHLQKYR 84
                     89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    
MFEGMERAGY GVGVGGAGAV GAGVVLSRDP KPRLRWTPDL HERFVEAVTK LGGPDKATPK  60
SVLRLMGMKG LTLYHLKSHL QKYRLGKQNK KDTGLEASRG AFAAHGISFA SAAPPTIPSA  120
ENNNAGETPL ADALRYQIEV QRKLHEQLEV QKKLQMRIEA QGKYLQTILE KAQNNLSYDA  180
TGTANLEATR TQLTDFNLAL SGFMNNVSQV CEQNNGELAK AISEDNLRTT NLGFQLYHGI  240
QDSDDVKCSQ DEGLLLLDLN IKGGGYDHLS SNAMRGGESG LKISQHRR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-64G2-like family protein