PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G10130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 537aa    MW: 56170.8 Da    PI: 6.7092
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G10130.1genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27213267156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k +++WtpeLH+rFv+aveqL G++kA+P++ilelm++++Lt+++++SHLQkYR++
  OGLUM01G10130.1 213 KVKVDWTPELHRRFVQAVEQL-GIDKAVPSRILELMGIECLTRHNIASHLQKYRSH 267
                      5689*****************.********************************86 PP

2Myb_DNA-binding39.71.1e-12216265248
                      SSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg..tWktIartmg.kgRtlkqcksrwqkyl 48 
                        WT+e++ ++v+av+qlG +   +++I + mg + +t+ ++ s++qky+
  OGLUM01G10130.1 216 VDWTPELHRRFVQAVEQLGIDkaVPSRILELMGiECLTRHNIASHLQKYR 265
                      57********************************999************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    
MLEVSTLRSP KADQRAGVGG HHVVGFVPAP PSPADVADEV DAFIVDDSCL LEYIDFSCCD  60
VPFFHADDGD ILPDLEVDPT ELLAEFASSP DDKPPPTTSA PGPGEPAAAA GAKEDVKEDG  120
AAAAAAAADY DGSPPPPRGK KKKDDEERSS SLPEEKDAKN GGGDEVLSAV TTEDSSAGAA  180
KSCSPSAEGH SKRKPSSSSS SAAAGKNSHG KRKVKVDWTP ELHRRFVQAV EQLGIDKAVP  240
SRILELMGIE CLTRHNIASH LQKYRSHRKH LMAREAEAAS WTQKRQMYTA AAAAATVAAG  300
GGPRKDAAAA TAAVAPWVMP TIGFPPPHAA AMVPPPPHPP PFCRPPLHVW GHPTAGVEPT  360
TAAAPPPPSP HAQPPLLPVW PRHLAPPPPP LPAAWAHGHQ PAPVDPAAYW QQQYNAARKW  420
GPQAVTPGTP CMPPPLPPAA MLQRFPVPPV PGMVPHPMYR PIPPPSPPQG NKLAALQLQL  480
DAHPSKESID AAIGDVLVKP WLPLPLGLKP PSLDSVMSEL HKQGIPKVPP AASGAAG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138144RGKKKKD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-44G2-like family protein