PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT36547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 591aa    MW: 64315.6 Da    PI: 7.9529
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT36547genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.7e-31248305260
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
               dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  OIT36547 248 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 305
               8****************************************.***************85 PP

2WRKY106.21.7e-33412470159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  OIT36547 412 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGRHNHD 470
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    
MEDSHSKSHS HSHSQQQHSS SEQLRDGISA VNDGGISSGA AGFNGGAKYK FMTPAKLPIS  60
RSTCITIPPG LSPSSFLESP VLLSNIKAEP SPTTGSFSKL QAVQGSGGNA AFLLKRGYSS  120
GNTYSEGKSS CFEFKFAGGS SSTSGFVAEH VISTGLNQQQ NEPLKEVQDQ SHPQLVATSS  180
LAKHKMASSK ELSLSAPINV DDFSKEESLS APINVDAMNM RGQSNTSMQV SLADHKDVSS  240
VTAERSSDDG YNWRKYGQKL VKGSEFPRSY YKCTYPNCEV KKIFERSPEG QITEIVYKGS  300
HDHPKPQLSR RFTPGALMSI QEDKFFVEDK FNTNAQTGKI EPISTPVSPQ QVDADGPEGA  360
VSQMQGTSDD MDEDDPFVKR RKMDGAMDIT PVIKPIREPR VVVQTVSEVD ILDDGYRWRK  420
YGQKVVRGNP NPRSYYKCTN AGCPVRKHVE RASHDPKAVI TTYEGRHNHD VPAARSNNHE  480
MAGSTPVTGG SRIRAEETYS INLDLGVGIG YGVENGNNRQ LHTVHNQVQV SRSGMMVVQP  540
AAIAARYGIV NGSMSRFGPI DNHVQGHGFE TLPLQPSTQF PQNYGKILLG P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-154WRKY family protein