PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIT24261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 338aa    MW: 37984.2 Da    PI: 6.2587
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIT24261genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.1e-32162220159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDg++WrKYGqK vk+s+fprsYYrCt+ +C vkk+vers +d+++v++tYeg+H+h+
  OIT24261 162 LDDGFRWRKYGQKAVKSSPFPRSYYRCTTISCGVKKRVERSVKDTSIVITTYEGTHTHP 220
               59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    
MEKENKLKAE TSLENPMFSQ QIQTSFSLPN IFDMLCETEK DSLGFLDNMF GAHLLDFNTT  60
IPSIFDLLQT PPPQSLAIIP SPTSTFQESS ELVNNPTTPN SLSISSSSTE AAEDDQQSNT  120
VKQQDEDEDK YKKQLKPKKT NVQKRQREPR FAFMTKSEID HLDDGFRWRK YGQKAVKSSP  180
FPRSYYRCTT ISCGVKKRVE RSVKDTSIVI TTYEGTHTHP CRITPPQSIG GALPRTTTYY  240
DGAIGGGNSG GGGIYSNSPL SIPQLQYYQD QQQQPLHYSP TTTLPLNNFN VGYSSLFSTN  300
SLQERRYSPY PYSSSLAGDD GLLHDMVSSQ MRRDTKED
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.14e-44WRKY family protein