PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G47260.1

Common Name

ATWRKY23, T8I13.10, WRKY23

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 337aa MW: 37684.7 Da PI: 6.9536

Description

WRKY DNA-binding protein 23

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G47260.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.6	2.7e-33	174	230	2	58
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h AT2G47260.1 174 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 230 8******************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF038130	5.7E-129	1	337	IPR017396	PWRKY transcription factor, group IIc
Gene3D	G3DSA:2.20.25.80	7.9E-34	158	232	IPR003657	WRKY domain
SuperFamily	SSF118290	1.7E-28	165	231	IPR003657	WRKY domain
PROSITE profile	PS50811	30.963	168	233	IPR003657	WRKY domain
SMART	SM00774	1.0E-38	173	232	IPR003657	WRKY domain
Pfam	PF03106	7.7E-26	174	230	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009624	Biological Process	response to nematode
GO:0009733	Biological Process	response to auxin
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001017	developmental stage	M germinated pollen stage
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 337 aa Download sequence Send to blast
MEFTDFSKTS FYYPSSQSVW DFGDLAAAER HSLGFMELLS SQQHQDFATV SPHSFLLQTS 60 QPQTQTQPSA KLSSSIIQAP PSEQLVTSKV ESLCSDHLLI NPPATPNSSS ISSASSEALN 120 EEKPKTEDNE EEGGEDQQEK SHTKKQLKAK KNNQKRQREA RVAFMTKSEV DHLEDGYRWR 180 KYGQKAVKNS PFPRSYYRCT TASCNVKKRV ERSFRDPSTV VTTYEGQHTH ISPLTSRPIS 240 TGGFFGSSGA ASSLGNGCFG FPIDGSTLIS PQFQQLVQYH HQQQQQELMS CFGGVNEYLN 300 SHANEYGDDN RVKKSRVLVK DNGLLQDVVP SHMLKEE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-28	163	233	7	77	Probable WRKY transcription factor 4
2lex_A	6e-28	163	233	7	77	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.24867	0.0	root\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42570003	0.0
Genevisible	260528_at	0.0
Expression Atlas	AT2G47260	-
AtGenExpress	AT2G47260	-
ATTED-II	AT2G47260	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of WRKY Transcription Factor; Group I. Involved in nematode feeding site establishment.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
WRKY23 is expressed during the early stages of nematode feeding site establishment. [PMID: 18599655] results suggest a model in which WRKY23 is part of a transcriptional feedback loop of auxin on its own transport through local regulation of flavonol biosynthesis [PMID: 22307611] Knocking down WRKY23 transcript levels or expression of a dominant-negative WRKY23 affected both apical-basal axis formation as well as installation of the root stem cell niche. [PMID: 24157946] Gain- and loss-of-function mutants confirmed a role for WRKY23 in mediating the auxin effect on the PIN polarity. Accordingly, processes requiring auxin-mediated PIN polarity rearrangements, such as vascular tissue development during leaf venation, showed a higher WRKY23 expression and required the WRKY23 activity. [PMID: 29377885]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00069	PBM	25215497	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G47260.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
IntAct	Search O22900

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G47260

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117918	0.0	AK117918.1 Arabidopsis thaliana At2g47260 mRNA for putative WRKY-type DNA binding protein, complete cds, clone: RAFL19-10-C13.
GenBank	AY052647	0.0	AY052647.1 Arabidopsis thaliana WRKY transcription factor 23 (WRKY23) mRNA, complete cds.
GenBank	BT006238	0.0	BT006238.1 Arabidopsis thaliana At2g47260 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_182248.1	0.0	WRKY DNA-binding protein 23
Swissprot	O22900	0.0	WRK23_ARATH; WRKY transcription factor 23
TrEMBL	A0A178VQ40	0.0	A0A178VQ40_ARATH; WRKY23
STRING	AT2G47260.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6152	26	47
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT2G47260.1
Entrez Gene	819339
iHOP	AT2G47260
wikigenes	AT2G47260

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Rashotte AM,Carson SD,To JP,Kieber JJ Expression profiling of cytokinin action in Arabidopsis. Plant Physiol., 2003. 132(4): p. 1998-2011 [PMID:12913156] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Goda H, et al. Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] Ohashi-Ito K,Kubo M,Demura T,Fukuda H Class III homeodomain leucine-zipper proteins regulate xylem cell differentiation. Plant Cell Physiol., 2005. 46(10): p. 1646-56 [PMID:16081527] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lee DJ, et al. Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response. Mol. Genet. Genomics, 2007. 277(2): p. 115-37 [PMID:17061125] Grunewald W, et al. A role for AtWRKY23 in feeding site establishment of plant-parasitic nematodes. Plant Physiol., 2008. 148(1): p. 358-68 [PMID:18599655] Lev Expression profiling and functional analysis of Populus WRKY23 reveals a regulatory role in defense. New Phytol., 2009. 184(1): p. 48-70 [PMID:19674332] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Grunewald W, et al. Transcription factor WRKY23 assists auxin distribution patterns during Arabidopsis root development through local control on flavonol biosynthesis. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1554-9 [PMID:22307611] Grunewald W, et al. Tightly controlled WRKY23 expression mediates Arabidopsis embryo development. EMBO Rep., 2013. 14(12): p. 1136-42 [PMID:24157946] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Prát T, et al. WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity. PLoS Genet., 2018. 14(1): p. e1007177 [PMID:29377885]