PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIS99892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 224aa    MW: 25710 Da    PI: 4.3349
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIS99892genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601132e-35111111101
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
               aCaaCk++r+kC ++C lapyfp++++++f+nv +lFG++n +kll+++ ++++e+++++l+ eA+++ ++PvyG++g+ +kl+ ++e  ++el+++++++
  OIS99892  11 ACAACKHQRKKCDENCQLAPYFPSNRSEDFQNVYRLFGVNNTIKLLNSVADDQKEKTAETLILEAKVWKENPVYGCLGIERKLRVEIEAYEKELEMVRKQI 111
               7***********************************************************************************************99986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    
MNADMLMFVG ACAACKHQRK KCDENCQLAP YFPSNRSEDF QNVYRLFGVN NTIKLLNSVA  60
DDQKEKTAET LILEAKVWKE NPVYGCLGIE RKLRVEIEAY EKELEMVRKQ ISFCKEMATL  120
QMQRQQLEEQ LDQSSLALVS PFDVPYHDKK NEAIFMSDTK NFYGYKYDST NLDEVANVEC  180
IAIQDADFDH PAFVEPESAR VDEFKGCEIE AISITGEEEI ADLQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-28LBD family protein