PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OIS95927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 181aa    MW: 20827 Da    PI: 6.273
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OIS95927genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.1e-30118176159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver++ed ++v++tYeg Hnh+
  OIS95927 118 LDDGYKWRKYGKKMVKDSPNPRNYYRCSIEGCPVKKRVERDKEDCRYVITTYEGVHNHQ 176
               59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    
MYTMRIQSIT MAANNPSTNM SYGSFRSLDS PDSDFSNQLI NFELSDIFEL DNWPVHDDPT  60
SVVSDTSQYS NYAANEVVAT ERSRSYREGP SNNIGSSSER KEVKDKVAFK TLSQIEILDD  120
GYKWRKYGKK MVKDSPNPRN YYRCSIEGCP VKKRVERDKE DCRYVITTYE GVHNHQGPSQ  180
F
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-41WRKY family protein