PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G26170.1 | ||||||||
Common Name | ATWRKY50, T19G15.20, WRKY50 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 173aa MW: 19291.2 Da PI: 6.3536 | ||||||||
Description | WRKY DNA-binding protein 50 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.8 | 3.9e-32 | 112 | 170 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg+Hnh+ AT5G26170.1 112 LDDGFKWRKYGKKMVKNSPHPRNYYKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNHS 170 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.3E-34 | 99 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.06E-29 | 105 | 170 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.021 | 107 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.7E-37 | 112 | 171 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.1E-26 | 113 | 169 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MNDADTNLGS SFSDDTHSVF EFPELDLSDE WMDDDLVSAV SGMNQSYGYQ TSDVAGALFS 60 GSSSCFSHPE SPSTKTYVAA TATASADNQN KKEKKKIKGR VAFKTRSEVE VLDDGFKWRK 120 YGKKMVKNSP HPRNYYKCSV DGCPVKKRVE RDRDDPSFVI TTYEGSHNHS SMN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-27 | 99 | 169 | 4 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-27 | 99 | 169 | 4 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AT5G26170 | |||||
AtGenExpress | AT5G26170 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group II-c | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G26170.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q8VWQ5 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G26170 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY071847 | 0.0 | AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_197989.2 | 1e-127 | WRKY DNA-binding protein 50 | ||||
Swissprot | Q8VWQ5 | 1e-128 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | C0SVQ6 | 1e-126 | C0SVQ6_ARATH; Uncharacterized protein At5g26170 (Fragment) | ||||
STRING | AT5G26170.1 | 1e-127 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G26170.1 |
Entrez Gene | 832686 |
iHOP | AT5G26170 |
wikigenes | AT5G26170 |