PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_019180037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 279aa    MW: 30446.3 Da    PI: 7.7566
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_019180037.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-3349103155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrW++eLHerFv+ v+qLGG+++AtPk +l+lm+v+gLt++hvkSHLQkYRl
  XP_019180037.1  49 KQRLRWSHELHERFVDSVAQLGGPDRATPKGVLRLMGVQGLTIYHVKSHLQKYRL 103
                     79****************************************************8 PP

2Myb_DNA-binding58.41.6e-1851102148
                      TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...tWktIartmg.kgRtlkqcksrwqkyl 48 
                      r+rW+ e++e++vd v+qlGg+   t+k + r mg +g+t +++ks++qky+
   XP_019180037.1  51 RLRWSHELHERFVDSVAQLGGPdraTPKGVLRLMGvQGLTIYHVKSHLQKYR 102
                      89*************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    
MYQPKAVLSS SLVPNKAIVS QQTLDFSAST MEPINGDNNL NNNPSLASKQ RLRWSHELHE  60
RFVDSVAQLG GPDRATPKGV LRLMGVQGLT IYHVKSHLQK YRLSKYLPDA SSDGKKPDKK  120
DSSDIISGLD DSSGMQITEA LKLQMEVQKR LHEQLEVQRQ LQLRIEAQGK YLKKIIEEQQ  180
QLEMPESSGA TSASAGENAP VSDNSTNPVT PVPASEKPEN EQRNPVKGIS LNASPSSHNE  240
ALSPDSSCPA VERPSKKQKV SAEAAAFTQP DAMLTKLLG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-65G2-like family protein