PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN18496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 186aa    MW: 22099.1 Da    PI: 5.3773
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN18496.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM69.87.3e-22231521128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev..ikevdiykvePwdLpkkvkaeekewyfFskrdk.kyatgkrknr.atksgyWkatgkdkevlsk 95 
                 lp G rF Ptd+el+  yL++kv  + l+++ +  i+ +++y+v+P+ L +++ ++e e yfF++ ++  y + ++ +r     gyW+  gk+ +v+++
  PIN18496.1  23 LPLGWRFVPTDQELIISYLTNKVFFRALPAKAIkeIDAMELYSVHPKVLVESI-SNEPEHYFFVRDHEyFYGEINKMKRvGDGIGYWRCIGKEDPVHDA 120
                 699********************99997774323377778*********8665.4466888887755415667778888445589*************9 PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                 +g+l   k   +++    pk  +t+W ++ yrl
  PIN18496.1 121 EGNLRAFKIHSTYF-SIIPKRMRTHWRLEVYRL 152
                 99999999999999.5667779*********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    
MASVERIQTE LQLDSEEENQ IELPLGWRFV PTDQELIISY LTNKVFFRAL PAKAIKEIDA  60
MELYSVHPKV LVESISNEPE HYFFVRDHEY FYGEINKMKR VGDGIGYWRC IGKEDPVHDA  120
EGNLRAFKIH STYFSIIPKR MRTHWRLEVY RLVDIEPSTE DEEELHVGEW VVARITRGKD  180
PRKQWF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.12e-20NAC family protein