PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G08790.1

Common Name

anac081, ATAF2, NAC081, T2K12.140

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 283aa MW: 32225.2 Da PI: 5.4696

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G08790.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.4	4.2e-51	7	131	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lp+GfrFhPtdeelv++yL++k++++++++ vi+e+d+yk++Pw+Lp++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + + AT5G08790.1 7 LPAGFRFHPTDEELVKFYLCRKCASEQISA-PVIAEIDLYKFNPWELPEMSLYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PK 101 799***********************99.89***********66566899********************************98..77 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 + g+kk Lvfy g+apkg kt+W+mheyrl AT5G08790.1 102 TLGIKKALVFYAGKAPKGIKTNWIMHEYRL 131 8*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.35E-60	4	159	IPR003441	NAC domain
PROSITE profile	PS51005	59.009	7	159	IPR003441	NAC domain
Pfam	PF02365	7.1E-27	8	131	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007275	Biological Process	multicellular organism development
GO:0008361	Biological Process	regulation of cell size
GO:0009416	Biological Process	response to light stimulus
GO:0009611	Biological Process	response to wounding
GO:0009620	Biological Process	response to fungus
GO:0009744	Biological Process	response to sucrose
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0043424	Molecular Function	protein histidine kinase binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0003018	anatomy	root cap of lateral root
PO:0006340	anatomy	adult vascular leaf
PO:0020030	anatomy	cotyledon
PO:0020121	anatomy	lateral root

Sequence ? help Back to Top
Protein Sequence Length: 283 aa Download sequence Send to blast
MKSELNLPAG FRFHPTDEEL VKFYLCRKCA SEQISAPVIA EIDLYKFNPW ELPEMSLYGE 60 KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI 120 KTNWIMHEYR LANVDRSASV NKKNNLRLDD WVLCRIYNKK GTMEKYFPAD EKPRTTTMAE 180 QSSSPFDTSD STYPTLQEDD SSSSGGHGHV VSPDVLEVQS EPKWGELEDA LEAFDTSMFG 240 SSMELLQPDA FVPQFLYQSD YFTSFQDPPE QKPFLNWSFA PQG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	7e-84	2	165	10	174	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.27826	0.0	flower\| inflorescence\| leaf\| root\| seed

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT5G08790
AtGenExpress	AT5G08790

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, cotyledons, rosette leaves, cauline leaves and mature flowers. Expressed at low levels in stems and flower buds. {ECO:0000269\|PubMed:16115070}.

Functional Description ? help Back to Top
Source	Description
TAIR	induced by wounding, belongs to a large family of putative transcriptional activators with NAC domain.
UniProt	Involved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22937923, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403, ECO:0000269\|PubMed:26518251}.

Function -- GeneRIF ? help Back to Top
ATAF2 overexpressing plants showed a higher susceptibility to the soil-borne fungal pathogen F.oxysporum, and repression of a number of pathogenesis-related proteins. [PMID: 16115070] The identification of a cis-regulatory binding sequence for ATAF2, is reported. [PMID: 22937923] ATAF2 regulates NIT2 gene expression via NIT2 promoter binding. [PMID: 22965747] ATAF2 acts as a central regulator of plant defense, hormone metabolism and light-mediated seedling development [PMID: 26493403]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G08790.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:17722694, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G08790
IntAct	Search Q9C598

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G08790

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228803	0.0	AK228803.1 Arabidopsis thaliana mRNA for ATAF2 protein, complete cds, clone: RAFL16-12-H06.
GenBank	AY080862	0.0	AY080862.1 Arabidopsis thaliana unknown protein (At5g08790) mRNA, complete cds.
GenBank	AY133762	0.0	AY133762.1 Arabidopsis thaliana clone U18877 unknown protein (At5g08980) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_680161.1	0.0	NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
Swissprot	Q9C598	0.0	NAC81_ARATH; Protein ATAF2
TrEMBL	A0A178URJ7	0.0	A0A178URJ7_ARATH; ATAF2
STRING	AT5G08790.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM190	28	276
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT5G08790.1
Entrez Gene	830779
iHOP	AT5G08790
wikigenes	AT5G08790

Publications ? help Back to Top
Collinge M,Boller T Differential induction of two potato genes, Stprx2 and StNAC, in response to infection by Phytophthora infestans and to wounding. Plant Mol. Biol., 2001. 46(5): p. 521-9 [PMID:11516145] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Mart Genomic analysis of the unfolded protein response in Arabidopsis shows its connection to important cellular processes. Plant Cell, 2003. 15(2): p. 561-76 [PMID:12566592] Greve K,La Cour T,Jensen MK,Poulsen FM,Skriver K Interactions between plant RING-H2 and plant-specific NAC (NAM/ATAF1/2/CUC2) proteins: RING-H2 molecular specificity and cellular localization. Biochem. J., 2003. 371(Pt 1): p. 97-108 [PMID:12646039] Hammond JP, et al. Changes in gene expression in Arabidopsis shoots during phosphate starvation and the potential for developing smart plants. Plant Physiol., 2003. 132(2): p. 578-96 [PMID:12805589] Ekman DR,Lorenz WW,Przybyla AE,Wolfe NL,Dean JF SAGE analysis of transcriptome responses in Arabidopsis roots exposed to 2,4,6-trinitrotoluene. Plant Physiol., 2003. 133(3): p. 1397-406 [PMID:14551330] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Hegedus D, et al. Molecular characterization of Brassica napus NAC domain transcriptional activators induced in response to biotic and abiotic stress. Plant Mol. Biol., 2003. 53(3): p. 383-97 [PMID:14750526] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Ernst HA,Olsen AN,Larsen S,Lo Leggio L Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors. EMBO Rep., 2004. 5(3): p. 297-303 [PMID:15083810] Delessert C, et al. The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis. Plant J., 2005. 43(5): p. 745-57 [PMID:16115070] Nakano T, et al. Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana. J. Plant Res., 2006. 119(4): p. 407-13 [PMID:16820983] Zhong R,Demura T,Ye ZH SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis. Plant Cell, 2006. 18(11): p. 3158-70 [PMID:17114348] Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] Dortay H, et al. Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana. J. Proteome Res., 2008. 7(9): p. 3649-60 [PMID:18642946] Abercrombie JM, et al. Transcriptional responses of Arabidopsis thaliana plants to As (V) stress. BMC Plant Biol., 2008. 8: p. 87 [PMID:18684332] Kunieda T, et al. NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2631-42 [PMID:18849494] Wang X,Goregaoker SP,Culver JN Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses. J. Virol., 2009. 83(19): p. 9720-30 [PMID:19625399] Miller MJ,Barrett-Wilt GA,Hua Z,Vierstra RD Proteomic analyses identify a diverse array of nuclear processes affected by small ubiquitin-like modifier conjugation in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(38): p. 16512-7 [PMID:20813957] Wang X,Culver JN DNA binding specificity of ATAF2, a NAC domain transcription factor targeted for degradation by Tobacco mosaic virus. BMC Plant Biol., 2012. 12: p. 157 [PMID:22937923] Huh SU,Lee SB,Kim HH,Paek KH ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis. Mol. Cells, 2012. 34(3): p. 305-13 [PMID:22965747] Zhao J,Favero DS,Peng H,Neff MM Arabidopsis thaliana AHL family modulates hypocotyl growth redundantly by interacting with each other via the PPC/DUF296 domain. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. E4688-97 [PMID:24218605] Peng H,Zhao J,Neff MM ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis. Development, 2015. 142(23): p. 4129-38 [PMID:26493403] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251]