PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN15473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 160aa    MW: 18711.4 Da    PI: 9.4476
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN15473.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.6e-53161421129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeel+++yL kkv ++ +++  +i evd++kvePw+Lp ++k +eke yfF+ rdkky+tg r+nrat++gyWkatgkdke+++ +++l
  PIN15473.1  16 LPPGFRFHPTDEELITHYLSKKVVDSGFSA-VAIGEVDMNKVEPWELPWRAKMGEKEFYFFCVRDKKYPTGLRTNRATAHGYWKATGKDKEIFR-GKTL 112
                 79*************************999.67***************8889999***************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg+kktLvfy+grapkgek++Wv heyrle
  PIN15473.1 113 VGMKKTLVFYRGRAPKGEKSNWVSHEYRLE 142
                 ****************************85 PP

Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    
MENYSEIPNR DDEMELPPGF RFHPTDEELI THYLSKKVVD SGFSAVAIGE VDMNKVEPWE  60
LPWRAKMGEK EFYFFCVRDK KYPTGLRTNR ATAHGYWKAT GKDKEIFRGK TLVGMKKTLV  120
FYRGRAPKGE KSNWVSHEYR LEGKFSLENL PKAVKVIDYH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.12e-91NAC family protein