PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PIN01794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Bignoniaceae; Crescentiina; Tabebuia alliance; Handroanthus
Family NAC
Protein Properties Length: 239aa    MW: 26639.6 Da    PI: 9.5872
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PIN01794.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1102.7e-34191442128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkd.kevlsk.kg 97 
                 p GfrFhPtd+el+ +yL++k+++ +l++ +vi+e+d+++++PwdLp     ++++ yfFskr+++   ++ ++   +  gyWk+tgk+ k+++   ++
  PIN01794.1  19 PIGFRFHPTDQELLLYYLRRKAQSLPLPA-SVIPEFDVFQSNPWDLPG---DSKEKRYFFSKRKRSIIVNNCSSLlRAGCGYWKSTGKEyKPIVGPgSN 113
                 89***************************.99***************3...356688********988655444435689*******963777777555 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g+kk+Lvf +g+ + g+k++W+mh++ l
  PIN01794.1 114 LVIGIKKSLVFCEGKISGGRKAQWIMHQFCL 144
                 569**************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    
MKGLNSEDGN GEGIRIAIPI GFRFHPTDQE LLLYYLRRKA QSLPLPASVI PEFDVFQSNP  60
WDLPGDSKEK RYFFSKRKRS IIVNNCSSLL RAGCGYWKST GKEYKPIVGP GSNLVIGIKK  120
SLVFCEGKIS GGRKAQWIMH QFCLVGAVLT PYLAQKVMIQ VGDWVVCCVY QRKRKARNIG  180
TVTRQVNTDN SQHKQGRMPS DDVEMGFSVS QASSSSSGFT EISSNDLDQE VSSQTCKLC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.19e-43NAC family protein