PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RWV83399.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Ensete
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 51aa MW: 5765.51 Da PI: 8.7839 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.9 | 3.2e-10 | 14 | 46 | 1 | 34 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 rg+W+++Ed++l d+++ +G g W+ +++ g + RWV83399.1 14 RGAWSAQEDQILTDYITTHGEGKWRDLPERAG-K 46 89****************************99.3 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 51 aa Download sequence |
MGRRPCCSKE GLTRGAWSAQ EDQILTDYIT THGEGKWRDL PERAGKKNSV M |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 1e-17 | MYB family protein |