Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 53.3 | 6.6e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rgrWT+eEde+l ++++ G g+W++ +++ g+ R++k+c++rw +yl
AT5G49330.1 14 RGRWTAEEDEILTKYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
8*******************************99************97 PP
|
2 | Myb_DNA-binding | 55.3 | 1.5e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+ T +E+e++v+++ +lG++ W++Ia +++ gRt++++k++w+++l
AT5G49330.1 67 RGNITSDEEEIIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
7999******************.*********.************986 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] - Baudry A, et al.
TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana. Plant J., 2004. 39(3): p. 366-80 [PMID:15255866] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Knight CA, et al.
Expression profiling and local adaptation of Boechera holboellii populations for water use efficiency across a naturally occurring water stress gradient. Mol. Ecol., 2006. 15(5): p. 1229-37 [PMID:16626450] - Oravecz A, et al.
CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis. Plant Cell, 2006. 18(8): p. 1975-90 [PMID:16829591] - Bezhani S, et al.
Unique, shared, and redundant roles for the Arabidopsis SWI/SNF chromatin remodeling ATPases BRAHMA and SPLAYED. Plant Cell, 2007. 19(2): p. 403-16 [PMID:17293567] - Stracke R, et al.
Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling. Plant J., 2007. 50(4): p. 660-77 [PMID:17419845] - Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A
Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] - Yonekura-Sakakibara K, et al.
Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis. Plant Cell, 2008. 20(8): p. 2160-76 [PMID:18757557] - Stracke R, et al.
The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation. Plant Cell Environ., 2010. 33(1): p. 88-103 [PMID:19895401] - Stracke R, et al.
Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation. New Phytol., 2010. 188(4): p. 985-1000 [PMID:20731781] - Li S,Zachgo S
TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana. Plant J., 2013. 76(6): p. 901-13 [PMID:24118612] - Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK
Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content. Sci Rep, 2014. 4: p. 5018 [PMID:24846090] - Lotkowska ME, et al.
The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] - Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] - Zhou Z,Schenke D,Miao Y,Cai D
Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] - Mondal SK,Roy S
Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] - Duan S, et al.
Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana. Plant Sci., 2018. 268: p. 47-53 [PMID:29362083]
|