PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_020700214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 26613.5 Da    PI: 10.1944
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_020700214.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.62.9e-271058250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    rien +nrqvtfskRrng+lKKA EL vLCdae+ +iifsstg+ly++ 
  XP_020700214.1 10 RIENITNRQVTFSKRRNGLLKKARELAVLCDAEIGLIIFSSTGRLYDFT 58
                    8**********************************************97 PP

2K-box82.59.3e-2875170398
           K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                     +++++  ++++++ +q+e++ L+++++nLq+++R+l+GedL+ Ls+keLq+Le+qLeksl+ i +kK+++l+++++el +k   +q+en++L ++
  XP_020700214.1  75 DHQQVMHAKSEHKIWQREATSLRQQLHNLQENHRQLMGEDLNGLSIKELQNLENQLEKSLQVIQQKKDQILINETQELNQKIAHMQRENMELYRM 169
                     45556689999*********************************************************************************998 PP

           K-box  98 l 98 
                     +
  XP_020700214.1 170 I 170
                     7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    
MGRGKIEIRR IENITNRQVT FSKRRNGLLK KARELAVLCD AEIGLIIFSS TGRLYDFTSS  60
SMKSVIGRYN KAKQDHQQVM HAKSEHKIWQ REATSLRQQL HNLQENHRQL MGEDLNGLSI  120
KELQNLENQL EKSLQVIQQK KDQILINETQ ELNQKIAHMQ RENMELYRMI NLCRQENMDL  180
NKKVNATKGF KGGSTSSNSG SPVTIYLELS PPQQKISGMH EDFPTLGLQL L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.12e-76MIKC_MADS family protein