PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62023852-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 311aa    MW: 36224.7 Da    PI: 8.547
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62023852-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.52.4e-133503786
                    EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3 37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                     l+d++ + W+vk+   +++  + +++GW++F+++++L+ gDf+vF+++g
  AUR62023852-RA  3 LLRDKNKKIWDVKIELINNK--VQFKDGWEKFCNDHDLQIGDFLVFMHQG 50
                    589***********666665..669**********************876 PP

2B346.37.8e-151021701686
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     l +pk+     g++ ee+k++ l+d+s + W+v++  + +++++ +++GW++F+++++L+ gDf+ +k++g
  AUR62023852-RA 102 LPIPKPINIGVGSEIEEDKMILLRDKSKKIWDVNI--ELSKNKVQFKDGWEKFCQDHNLQIGDFLELKYQG 170
                     5677777666677888999****************..77777788***********************976 PP

3B337.83.4e-12221304896
                     -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +++ ks++l +p +fa+++g++k++   + + de+gr+W + ++y+k++ +y+  +  ++   ang k gDfv+++l++ se+e+v+++
  AUR62023852-RA 221 NHSYKSAQLFIPLEFARKNGLDKRQ--YVGIIDEKGRKWVLPFKYTKGKYAYI--GKLRGLYGANGFKIGDFVILELIQ-SEKEPVIRF 304
                     56778889**************887..69999**********97777765554..56*********************9.777788876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    
MALLRDKNKK IWDVKIELIN NKVQFKDGWE KFCNDHDLQI GDFLVFMHQG YWVFDVFVFD  60
STAYVHVGLS REVNNNVLEQ RNMGSRPSTF VLQNCSYESV ALPIPKPINI GVGSEIEEDK  120
MILLRDKSKK IWDVNIELSK NKVQFKDGWE KFCQDHNLQI GDFLELKYQG YLVFDVSVIV  180
DPTAHVDERL SNRTENNKVQ EQKNIGFDPT GHPYCTFVLM NHSYKSAQLF IPLEFARKNG  240
LDKRQYVGII DEKGRKWVLP FKYTKGKYAY IGKLRGLYGA NGFKIGDFVI LELIQSEKEP  300
VIRFHNLLRW *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.18e-24B3 family protein