PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023553337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 501aa    MW: 55325.2 Da    PI: 7.0079
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023553337.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.3e-31156213260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  XP_023553337.1 156 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIVYKGTHDHPK 213
                     8****************************************.***************85 PP

2WRKY105.52.8e-33327385159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_023553337.1 327 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 385
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    
MLLSVEPSPT TGSFTKLPMA HDSSSSAIYP MTTMACSNAN ASDEGNSNYF EFKPYVGPNM  60
VPADMSHRKD EQSCELQVQG QPQPFTAPPM TKSEINVISN DSNRSTQMDP VASGAAVPDI  120
DGDDFNHSLN TNTRAQAAQS DPKGSGSPVV SDRISDDGYN WRKYGQKHVK GSEFPRSYYK  180
CTHPNCEVKK LFERSHDGQI TDIVYKGTHD HPKLQPSRRY SASASVKDGP DKPSPLTGQD  240
DRSCSIYTRT VHSIEPNGTP ERLAANDSNT EGAGTTLPCK NPDELDDNDI ILKRRKMELG  300
GFEACPMVRP IREPRVVVQT LSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNVGCPV  360
RKHVERASHD PKAVITTYEG KHNHDVPTAK TSSHDAAGPL RTAPLRYRLE DRDTVSLDLG  420
VGIGENRSNE YRQQALAPNG NFNFEVVQEN SAPTYFSVHN RGMNQHGPRE SLSESRSVDV  480
VPLNHSSHPY PPSVGRILTG P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-153WRKY family protein