PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023549393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 293aa    MW: 33627.6 Da    PI: 7.9378
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023549393.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-32131188259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts  C+vkk+ver  +dp++v++tYeg+H+h+
  XP_023549393.1 131 EDGYRWRKYGQKAVKNSPYPRSYYRCTSVACNVKKRVERYLKDPSIVVTTYEGQHTHS 188
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    
MEEVAAADSL RFPLPENQSC LKFMELIAVD QEFSSQFDVF SLSSLSSSLF TNPVENLEIG  60
NQWPTTPNYS SSSEIVNDEV IEPKLEREEK QHSRQTLKTD KQLKTKKMTR KKKDQEPRFA  120
FMTKSEVDHL EDGYRWRKYG QKAVKNSPYP RSYYRCTSVA CNVKKRVERY LKDPSIVVTT  180
YEGQHTHSSP NMTRSTFFPP PISTALYNGS TMFTTATTTP SLFHYQNGHN SNFINHPKGF  240
VASSFHPPCD VAPSNHANQF FSPTINHRLL QDIAPFQYDE LAWRDCSISQ NPT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-44WRKY family protein