PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023527795.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 213aa    MW: 24293.9 Da    PI: 8.8101
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023527795.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32139197159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  XP_023527795.1 139 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 197
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    
METGSQISGL PSYQLQLSFH LSNAPPLPQP IHQMGFVHFQ DHTQVLSFLS PNTAATATMP  60
PAFTTSAHAH LVSRPSWSNE QVGTQDPKPG NDENCNGSAS DGNNSWWRNT NADKSKVKVR  120
RKLREPRFCF QTRSDVDVLD DGYKWRKYGQ KVVKNSLHPR SYYRCTHNNC RVKKRVERLS  180
EDCRMVITTY EGRHNHSPCD DSNSSEHEPF TSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118124KVRRKLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.15e-66WRKY family protein