PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G44745.1 | ||||||||
Common Name | AtWRKY12, F16B22.46, WRKY12 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 218aa MW: 24548 Da PI: 8.7243 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.9 | 1.8e-32 | 144 | 201 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh AT2G44745.1 144 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 201 59******************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.4E-34 | 129 | 201 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-28 | 136 | 201 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.585 | 139 | 201 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-37 | 144 | 203 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-25 | 145 | 201 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MEGGGRRVFS NYDLQQVTSS STTIQENMNF LVPFEETNVL TFFSSSSSSS LSSPSFPIHN 60 SSSTTTTHAP LGFSNNLQGG GPLGSKVVND DQENFGGGTN NDAHSNSWWR SNSGSGDMKN 120 KVKIRRKLRE PRFCFQTKSD VDVLDDGYKW RKYGQKVVKN SLHPRSYYRC THNNCRVKKR 180 VERLSEDCRM VITTYEGRHN HIPSDDSTSP DHDCLSSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-26 | 135 | 201 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-26 | 135 | 201 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 122 | 128 | KIRRKLR |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 266886_at | 0.0 | ||||
Expression Atlas | AT2G44745 | - | ||||
AtGenExpress | AT2G44745 | - | ||||
ATTED-II | AT2G44745 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00618 | PBM | 24477691 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G44745.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G44745 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF404857 | 0.0 | AF404857.1 Arabidopsis thaliana WRKY transcription factor 12 (WRKY12) mRNA, complete cds. | |||
GenBank | BT028992 | 0.0 | BT028992.1 Arabidopsis thaliana At2g44745 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_566025.2 | 1e-162 | WRKY family transcription factor | ||||
Swissprot | Q93WY4 | 1e-163 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | Q1PEU5 | 1e-161 | Q1PEU5_ARATH; At2g44745 | ||||
STRING | AT2G44745.1 | 1e-162 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6045 | 25 | 46 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G44745.1 |
Entrez Gene | 819083 |
iHOP | AT2G44745 |
wikigenes | AT2G44745 |