PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023525508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 299aa    MW: 32628.7 Da    PI: 8.2792
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023525508.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-33135192259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt a+C+vkk+vers  dp+vv++tYeg+H+h+
  XP_023525508.1 135 EDGYRWRKYGQKAVKNSPFPRSYYRCTNASCNVKKRVERSFVDPTVVVTTYEGQHTHP 192
                     8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    
MEKKKEEIMN SGGGSGGGGG GGGGYLPFSD SMTGGSLFDF CDGEKLSVGF MELLGVKNGE  60
FKDYCSEVVN PPDTPNSSSI SSPSTDAADH DADGENPQQQ HKPCNNPLKV KRRKQKREKG  120
QRFAFMTKSE VDHLEDGYRW RKYGQKAVKN SPFPRSYYRC TNASCNVKKR VERSFVDPTV  180
VVTTYEGQHT HPSPILTRSA LAIATPPPPS MLGGGCVGVA PIPWLKASND THAISHQYIQ  240
NSTFYPPQHS TVDYNRSLIG AANMAGLLQD KRLCNPNPAF LADHGLLQDV VPPHMLKQE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112119RRKQKREK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.19e-52WRKY family protein