PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023522245.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 267aa    MW: 29506.2 Da    PI: 8.6913
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023522245.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.3e-34105163159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s++prsYYrCt+agC vkk+vers++dp+vv++tYeg+Hnh+
  XP_023522245.1 105 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTAGCGVKKRVERSSHDPSVVVTTYEGQHNHQ 163
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    
MKDEIPSCML KFPMDSSSFK PSTLFDLFDL FSAATTPPPL PPSSSSSDRL LNIPSTPNSS  60
SLSSSSDAGD LDPFNQHKLK PKIKNEKRAT QPRFAFMTKT EMDHLDDGYR WRKYGQKAVK  120
NSPYPRSYYR CTTAGCGVKK RVERSSHDPS VVVTTYEGQH NHQSPILPRG SLSASISTSA  180
ALHPPPLLFQ HQQYTYTYTP PTPPPPPMEL VTCGGFEPMF QCFGEERRRI GGSSPSSASF  240
KDHGLLQDMI VPSSSSSSSS VHIPKEE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-44WRKY family protein