PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023520684.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 697aa    MW: 76542.8 Da    PI: 5.2747
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023520684.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.2e-33228285260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C vkkkvers  d++++ei+Y+g Hnh+k
  XP_023520684.1 228 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCIVKKKVERSL-DGQITEIIYTGAHNHSK 285
                     7****************************************.***************85 PP

2WRKY102.72e-32444500258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     +Dgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k+v++tYeg+Hnh
  XP_023520684.1 444 EDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERASHDLKCVITTYEGKHNH 500
                     8******************************************************** PP

Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    
MTGYRTSRQI MFMEVYGEHR ASKFGDDDVL VDVNGGSLAD RRASKRGRNG FNIAMARCPL  60
GSSMVRSPFL TIPSGFSPTV LLDSPIMLLN THDIPSPTTG TFPIHSIKDE NSLLNPIMLE  120
DGSSYGSEDS YYRFTPRGEL RLGNQEGETD HQTLMDYELL ADFPKEGCSV LEQYELGSSS  180
TDKNNVETCL SSVTHNQDIE QAAPPPPPPL ETEHKGSYVP VGMLKTSEDG YNWRKYGQKQ  240
VKGSEYPRSY YKCTHPNCIV KKKVERSLDG QITEIIYTGA HNHSKPDPTR RALLGSVLSQ  300
DDAPDTGEGG GSRAKLEGGL AWRNSHYGVK DWSVDGLERT SSVSAVTELS EPLYGKTVGG  360
FESIETPELS STLASHDDDD GGGGGGGNDD DELTNQGSIS ADDAEPELKR RRKEGISMET  420
SLGSRSVREQ RVVVQIETEF DILEDGYRWR KYGQKVVKGN PNPRSYYKCT SAGCSVRKHV  480
ERASHDLKCV ITTYEGKHNH LVPAARNSSS SSSSSSSTAQ ASSAAAAATQ AAAAPTRKSE  540
TQIQDLSTQF YPTPEFSSHE YQRSFGTAPP FCQLKFPPLQ TAFPALDFPI SLPLSQNLSA  600
FQVFLAERFL TPKQEHEEDN IYASFQAMTD TSSGSSSSSV SSVYQQTIKV MKKNGRWEVV  660
KSVLRCLIWS ILVVTTSGEE EVRPEFFISS VLDESEA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.14e-81WRKY family protein