PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023513700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 236aa    MW: 27513.8 Da    PI: 9.0065
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023513700.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1047.9e-3398155259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts  C+vkk+ver+ +dp++v++tYeg+H+h+
  XP_023513700.1  98 EDGYRWRKYGQKAVKNSPYPRSYYRCTSVACHVKKRVERCLKDPSIVITTYEGQHTHS 155
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    
MELDLIWSQF DMFSTSSYPI QNPAIDPENL EILNAWPTSS SQLINDELSE LNLEEEKKPR  60
QKTVKSNHSS KTKKTNQKKK EQEQRYTFMT KSKVDHLEDG YRWRKYGQKA VKNSPYPRSY  120
YRCTSVACHV KKRVERCLKD PSIVITTYEG QHTHSTPVMT RSTFFPPPIS TSLHEGSTSF  180
TTTPPYLFHN QNVHNLNFAR HPNDFVAPSF HHERLPQHTA SFDPFTHLFA STTNYE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.19e-42WRKY family protein