PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO80725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 273aa    MW: 31265.6 Da    PI: 4.4053
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO80725genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-2165118356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
               k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  OMO80725  65 KKRRLTPEQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 118
               5678*************************************************9 PP

2HD-ZIP_I/II135.61.7e-4364156193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eqv++LE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ ke+e+L++e+++
     OMO80725  64 EKKRRLTPEQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSYDSLLANYDSIVKENEKLKSEVAS 156
                  69**************************************************************************************99875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    
MESGRLFFNP STCQGNMLYL GNGESFFRGA RTMISMEETS KKRPFFSLQE ELYDEEYYDE  60
QSPEKKRRLT PEQVHMLEKS FETENKLEPE RKTQLAKKLG LQPRQVAVWF QNRRARWKTK  120
QLERDYDLLK SSYDSLLANY DSIVKENEKL KSEVASLTEK LQAKDATAEP VVSQKVELLP  180
VETVSSTQFN VKVEDRLSTG SAGSAVVDED APQLVDSGDS YFPNDEYPGC VCPIDGAQSE  240
EDDGSDDGRS YFSNVFTATE QQHEEPLGWW VWS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-91HD-ZIP family protein