PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMO56360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Grewioideae; Apeibeae; Corchorus
Family HD-ZIP
Protein Properties Length: 289aa    MW: 31889.8 Da    PI: 8.4731
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMO56360genomeEnsemblPlantsView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.5e-19144198256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
               rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  OMO56360 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 198
               788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40144233191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
     OMO56360 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 233
                  69*************************************************************************************9.55 PP

Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    
MGLDDACNTG LVLGLGFSST LETPSSKPKK LTSSASFEPS LTLGLSGESY QVVNNSTSGS  60
KNKVDVVING GGGYNYHHHE ETTAVNAAVG GDHLYRQASP HSAVSSFSSG RVKRERDLSY  120
EEVEVEKNNS SRVSDEDEDG VNARKKLRLT KEQSALLEES FKQHSTLNPK QKQALARQLN  180
LRPRQVEVWF QNRRARTKLK QTEVDCEFLK KCCETLTDEN RRLQKELQEL KALKLAQPFY  240
MHMPAATLTM CPSCERIGGV GADGNAKSPF SMASKPHFYN PFTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201RRARTKLKQ
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.17e-99HD-ZIP family protein