PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027102531.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 235aa    MW: 26266 Da    PI: 8.8036
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027102531.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.6e-32153211159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s++prsYYrC++++C+vkk+v+r ++d+++v++tYeg Hnh+
  XP_027102531.1 153 LDDGYRWRKYGQKSVKNSKYPRSYYRCSHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 211
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    
MNLRSSPLLF MEGQDQETPP LPLPVPSPPT NPSFLFAQPH LPSPNSSLIF PNISHSQPLV  60
LQDNLHDLVG LFSAPPPTPS GIPNIAHDNT NDQIMMPSLE TAPLTISDNA VAPSPEEVAI  120
KDKIRRAASS SSKNRKNAVP KVVFQTRSPD DILDDGYRWR KYGQKSVKNS KYPRSYYRCS  180
HHTCNVKKQV QRLSKDTSIV VTTYEGIHNH PCEKLMETLS PLLEQIQFLT RPVLM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-54WRKY family protein