PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027085251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 203aa    MW: 23206.4 Da    PI: 6.2442
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027085251.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.51e-31140198159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk+s++pr+YYrC+ +gCpvkk+ver++edp++v++tYeg Hnh+
  XP_027085251.1 140 LDDGFKWRKYGKKMVKNSPNPRNYYRCSIEGCPVKKRVERDKEDPRYVITTYEGIHNHQ 198
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    
MNIYQHLTTT ALHFTSLHLS SPIMDGNYDP NRFTNMSGYN YNSSSAFGSS YSSGMISGDT  60
NQSNFQVSEY FELDDWMEED QTFMPSGYST AQSPQQELTE VLGHPGGSSS QQSNRDIGGN  120
ERKENREKVA FKTKSEVEIL DDGFKWRKYG KKMVKNSPNP RNYYRCSIEG CPVKKRVERD  180
KEDPRYVITT YEGIHNHQGP SQF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.13e-44WRKY family protein