PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027072618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family WRKY
Protein Properties Length: 458aa    MW: 50439 Da    PI: 8.8588
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027072618.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.3e-32187243360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geH h+k
  XP_027072618.1 187 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHSHPK 243
                     9***************************************.***************85 PP

2WRKY102.82e-32375432259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k ver+++dp+++ +tYeg+Hnhe
  XP_027072618.1 375 RDGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKYVERTSDDPNAFMTTYEGKHNHE 432
                     7********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    
MEIKETEKVA IAKPVASRPT CSGFKSFSEL LAGAINASPS STCSEAAVTA IRPRTVRFKP  60
AVDHPSAGVA ASQANLCGAA VSSPTAKDLK ADGKCKVVYK PMAKLVSKTT VSLLANMEQE  120
LAEVEANFQL PNLVKPQCDN RSEPHQNFLS AAQKNKRVEP SNVTTQNLEE DQRSLAHTAN  180
GDRPSYDGYN WRKYGQKQVK GSEYPRSYYK CTHPNCPVKK KVERSLDGQI AEIVYKGEHS  240
HPKTQPVRRN SSDGHWQGTS GNESNNPLCR NQHSDKNECY EGTMENPNEF GFLAHSSYSG  300
GAPSCMHPTN GDLDNSSCHS GEFDEGREGL EGETEGPKRK RRKNDNQSNV AGTAAEGAQE  360
PQVLGQNSTD SEIIRDGFRW RKYGQKVVKG NPYPRSYYRC TSLKCNVRKY VERTSDDPNA  420
FMTTYEGKHN HEMPTKSTSS LAAKTSTKAL GTKKIYLD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337344PKRKRRKN
2338343KRKRRK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-108WRKY family protein