PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_027068450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Family HB-PHD
Protein Properties Length: 702aa    MW: 79059.2 Da    PI: 10.0624
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_027068450.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.43.9e-11484531653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     +f ++ +e L  +F++n  ps++ r  L+++lgL+ ++V  WF+N R+
  XP_027068450.1 484 RFPRHVVEKLRVVFAENELPSRTIRDNLSRQLGLESEKVNKWFKNARY 531
                     6778999***************************************97 PP

2HLH14.75.5e-05649681742
                     HHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHH CS
             HLH   7 erErrRRdriNsafeeLrellPkaskapskKlsKae 42 
                     e+E  R  ++++++e+L+++l  +   ps + sKa+
  XP_027068450.1 649 EAEMERLCKMKDKIEKLQQVLLRL---PSSRSSKAD 681
                     7899*******************9...999999996 PP

3PHD38.13.6e-13224278150
                     SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
             PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCke 50 
                     +C+ C+   +  ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ Ck+
  XP_027068450.1 224 ICAKCKLreAFPDNDIVLCDgTCNCAFHQKCLDPPLSTENIPPGdeGWFCRYCKS 278
                     588888854455********56********************9999*******97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    
MAGETKKRKR KGVSDSSQKE KSPKKQCSKG VKLKPKLQVK SGNSESKHMK KCFDRLGEGK  60
GNISRRKSIV KKAIMQKTKS LKKQSELKTS RKDEPEVKNS KDGGKRDSSD VGLQKAKRRK  120
RRKRRKENLE LDEASRLQRR TRYLLIKVKL EQNLIDAYSA EGWKGHSREK IKPEKELERA  180
KKQILKCKLG IREAICQLDV LSSVGHIEDS AVAPDGSVHH EHIICAKCKL REAFPDNDIV  240
LCDGTCNCAF HQKCLDPPLS TENIPPGDEG WFCRYCKSKM EILEVTNAHL GTNFPLESNW  300
QDIFKEEAAL LDGKESLLCP EEEWPSDDSE DVDYDPEGRE FHSPNSMSGS GSDSSVDVSS  360
SNSLSSIEDD ILLLSERLDK RHMVSEGNIA GVESDEATDC EVLSGPRQRK AVDYIKLHDE  420
MFGKNAVVSE QISEDEDWGP SRRKHRGKES NVESTVVTTG GNPGTSAEVK KKLSSGRSKR  480
PIFRFPRHVV EKLRVVFAEN ELPSRTIRDN LSRQLGLESE KVNKWFKNAR YLALKARKKA  540
KRLNASGPTV SKESASRSGE DKSADLVTSE NVAIEHELES PGLKSSSRRK TAHLMASAFT  600
RKRHKTALPP TNNKTPADFG DDVCLKLLRE KVKKKKKMNI KRTVMPEAEA EMERLCKMKD  660
KIEKLQQVLL RLPSSRSSKA DAAALNELAI IYVPVAELRE KR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1611KKRKRK
2629KKRKRKGVSDSSQKEKSPKKQCSK
3636KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
4730KKRKRKGVSDSSQKEKSPKKQCSK
5737KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
6838KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
7117123KRRKRRK
8117125KRRKRRKRR
9118124KRRKRRK
10118126KRRKRRKRR
11118127RRKRRKRRKE
12119149KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
13119125KRRKRRK
14119128RRKRRKRRKE
15120150KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
16120126KRRKRRK
17121151KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
18121127RRKRRKE
19122152KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
20122128RRKRRKE
21123153KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
22633663KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
23634664KKRKRKGVSDSSQKEKSPKKQCSKGVKLKPK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-96HB-PHD family protein