PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_07.1675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family EIL
Protein Properties Length: 305aa    MW: 34104 Da    PI: 4.4736
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_07.1675genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN395.51.2e-291145217353
                                    TGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX..XXXX.XXXXXXXXXXXXXXXX..... CS
                           EIN3 217 msptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss..slrk.qspkvtlsceqkedve..... 285
                                    msp+ie+ir+l+rqsk+lqdkm+akes+++l+v++qee+++++++++   ++     + +  ++  sc+ ++dve     
  evm.model.AsparagusV1_07.1675   1 MSPDIEKIRRLVRQSKCLQDKMTAKESATWLAVVKQEEDLYRELHPDaclPPvnCP-SiGTISFSSSCS-EYDVEgvdel 78 
                                    89*********************************************875335432.248888888888.99***65544 PP

                                    .XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                           EIN3 286 .gkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                                      ++e   ++    k+++++++++kr    +e++ v + + +++c++s++++s+++l+f d+ ++++++
  evm.model.AsparagusV1_07.1675  79 kNDEEVMNQKPIMMKEETNVEFIKKRA-AAGEPEVVVN-GCVYNCKNSECPHSDYRLGFLDRGARNNHQ 145
                                    333333333334444455********8.8999999865.577*************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    
MSPDIEKIRR LVRQSKCLQD KMTAKESATW LAVVKQEEDL YRELHPDACL PPVNCPSIGT  60
ISFSSSCSEY DVEGVDELKN DEEVMNQKPI MMKEETNVEF IKKRAAAGEP EVVVNGCVYN  120
CKNSECPHSD YRLGFLDRGA RNNHQFMCKY QNDLIPNFQV NENKPSVFNM PTTVNNPANN  180
PVNVANVSNL GIASDDQRSI DELMNLYDNS MNSNGNNNVY NTTTTTQVIG LGSNVYEEVT  240
RFSASLSFFS FPKILGQVES GYVNQPTNNV NADFRFGSPF SVPAMDFNEA SSMIANQNNS  300
NWFF*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.12e-41EIL family protein