PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_04.1815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family LBD
Protein Properties Length: 123aa    MW: 13269.8 Da    PI: 8.2287
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_04.1815genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26074.71.7e-231091186
                         DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilk 82
                                   +C aCk+lrrkCa+dCv+apyf +e+ ++    h     ++ +   +++p++er +a+ +++yeA+ar+rdPvyG+v++i++
  evm.model.AsparagusV1_04.1815 10 PCGACKFLRRKCASDCVFAPYFSNEHGSSSLRRH----STRCCGQQRHVPQHERCEAVVTIAYEAQARVRDPVYGCVSHIFA 87
                                   7*********************999976666555....468899999*********************************** PP

                         DUF260 83 lqqq 86
                                   lqqq
  evm.model.AsparagusV1_04.1815 88 LQQQ 91
                                   **98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    
MSSNSSAGSP CGACKFLRRK CASDCVFAPY FSNEHGSSSL RRHSTRCCGQ QRHVPQHERC  60
EAVVTIAYEA QARVRDPVYG CVSHIFALQQ QGLVPRLIGS PSGHNDNEEA PLGGSLGTLH  120
HY*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42430.15e-38LBD family protein