PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.AsparagusV1_01.3339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Asparagaceae; Asparagoideae; Asparagus
Family EIL
Protein Properties Length: 600aa    MW: 66933.8 Da    PI: 5.7295
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.AsparagusV1_01.3339genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3433.61.9e-132414031349
                                    XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                           EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipek 80 
                                    e+l++rmwkd+++lkrlker+k  l  ++a ++++k +++++qarrkkmsraQDgiLkYMlk m+vcna+GfvYgiipek
  evm.model.AsparagusV1_01.3339  41 EDLTRRMWKDKVKLKRLKERQKLAL--QQA-AKKSKPKQPSDQARRKKMSRAQDGILKYMLKLMQVCNARGFVYGIIPEK 117
                                    89*******************9876..554.88999******************************************** PP

                                    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TT CS
                           EIN3  81 gkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqr 160
                                    gkpv+gasd++raWWkekv+fd+ngpaai+ky+a+nl++++++++   + ++  sl++lqD+tlgSLLs+lmqhcdppqr
  evm.model.AsparagusV1_01.3339 118 GKPVSGASDNIRAWWKEKVKFDKNGPAAIAKYEAENLAAENAKNN---GGKNCYSLMDLQDATLGSLLSSLMQHCDPPQR 194
                                    ****************************************99998...99****************************** PP

                                    S--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--S CS
                           EIN3 161 rfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsa 240
                                    +fplekgv+pPWWPtG+e+ww +lgl+k q  ppykkphdlkk+wkv+vLt vikhmsp+ie+ir ++r+sk+lqdkm+a
  evm.model.AsparagusV1_01.3339 195 KFPLEKGVPPPWWPTGNEDWWINLGLPKGQI-PPYKKPHDLKKMWKVGVLTGVIKHMSPNIEKIRTHVRKSKCLQDKMTA 273
                                    ******************************9.9*********************************************** PP

                                    HHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXXXXXXXXXXXXXXXXX..XXXXXXXXXX........ CS
                           EIN3 241 kesfallsvlnqeekecatvsahss.........slrkqspkvtlsceqkedvegkkesk.ikhvqavktta........ 302
                                    kes ++l vln ee  +   s+++          ++++++++ t s+++++dv+  ++s   k+ q++++ +        
  evm.model.AsparagusV1_01.3339 274 KESSIWLGVLNGEETSILLPSSENGmsdvtenphNCHDERREDTNSSNNEYDVDDARDSIsSKAPQSCREFDvstggens 353
                                    **************99977777733446777766666688889999999999994444330344555555459999**** PP

                                    ......XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXX CS
                           EIN3 303 ......gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsi 349
                                          +++   +rk+ +++s++v     s   q+s++++ + ++ ++d+n+ 
  evm.model.AsparagusV1_01.3339 354 padgpiQATKKPRRKRARVSSKIVDRD--SAGSQNSHLEE-HRRNYIPDMNDA 403
                                    **9998888888888888888888776..78999999985.688888998875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    
MEQLMMIENG LGGDSSDFDV DDVRCENLAE NDVSEEEIEA EDLTRRMWKD KVKLKRLKER  60
QKLALQQAAK KSKPKQPSDQ ARRKKMSRAQ DGILKYMLKL MQVCNARGFV YGIIPEKGKP  120
VSGASDNIRA WWKEKVKFDK NGPAAIAKYE AENLAAENAK NNGGKNCYSL MDLQDATLGS  180
LLSSLMQHCD PPQRKFPLEK GVPPPWWPTG NEDWWINLGL PKGQIPPYKK PHDLKKMWKV  240
GVLTGVIKHM SPNIEKIRTH VRKSKCLQDK MTAKESSIWL GVLNGEETSI LLPSSENGMS  300
DVTENPHNCH DERREDTNSS NNEYDVDDAR DSISSKAPQS CREFDVSTGG ENSPADGPIQ  360
ATKKPRRKRA RVSSKIVDRD SAGSQNSHLE EHRRNYIPDM NDADLPAISY HMGNANLENY  420
TNPSSSTRDN HNENQLIVPE PGVANAHEID TNNQLSVPPL NAAVQNMYVD NHPLMYQDVF  480
NGNLHSQTPP FRVFPSSVGY GHTQNKEQMR TEDTGLAVGN HIYGHALDMN GSSEEIAGNV  540
HPLAVEEPIQ SDSNKYVGSQ FDSLYPMSHD FGLGSPLGSI PDIDDFILDD DDLMGYLGT*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-138EIL family protein