Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | EIN3 | 434.8 | 8.2e-133 | 38 | 401 | 1 | 351 |
XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
EIN3 1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98
++l++rmwkd+++lkr+ker+k + a +++ +k+++qa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWWkek
AT1G73730.1 38 DDLERRMWKDRVRLKRIKERQKAGS---QGAQTKETPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEK 132
79********************854...3445678899************************************************************ PP
XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
EIN3 99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
v+fd+ngpaai+ky+ ++l++++++++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtG+e+ww +lgl+k+q+ ppy+
AT1G73730.1 133 VKFDKNGPAAIAKYEEECLAFGKSDGN----RNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQS-PPYR 225
*********************987777....77999*********************************************************.9*** PP
-GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX......XXXX....XXXXXXXXXXXXX CS
EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss......slrk....qspkvtlsceqke 282
kphdlkk+wkv+vLtavi+hm p+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++++ s++ +s + +++k ++++++++
AT1G73730.1 226 KPHDLKKMWKVGVLTAVINHMLPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDngNSnvtethR--RgnnaDRRKPVVNSDSDY 321
*******************************************************************66226887540..3344477888999999** PP
XXXXXXXXX.XXXXXXXXXX..................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXX CS
EIN3 283 dvegkkeskikhvqavktta..................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisq 351
dv+g++e + + ++++++++ +++ +r+rk+++ +s +v + q+++ ++ ++++i++d+n+++
AT1G73730.1 322 DVDGTEEASGSVSSKDSRRNqiqkeqptaishsvrdqdKAEKHRRRKRPRIRSGTV-------NRQEEEQPEAQQRNILPDMNHVDA 401
***88888888888888777899999999977555544444444444444444444.......445566667899999999999875 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Yamasaki K, et al.
Solution structure of the major DNA-binding domain of Arabidopsis thaliana ethylene-insensitive3-like3. J. Mol. Biol., 2005. 348(2): p. 253-64 [PMID:15811366] - Wang J, et al.
Genomewide nonadditive gene regulation in Arabidopsis allotetraploids. Genetics, 2006. 172(1): p. 507-17 [PMID:16172500] - Maruyama-Nakashita A,Nakamura Y,Tohge T,Saito K,Takahashi H
Arabidopsis SLIM1 is a central transcriptional regulator of plant sulfur response and metabolism. Plant Cell, 2006. 18(11): p. 3235-51 [PMID:17114350] - Binder BM, et al.
The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling. Plant Cell, 2007. 19(2): p. 509-23 [PMID:17307926] - Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] - Van der Ent S, et al.
MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis. Plant Physiol., 2008. 146(3): p. 1293-304 [PMID:18218967] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Kawashima CG, et al.
Sulphur starvation induces the expression of microRNA-395 and one of its target genes but in different cell types. Plant J., 2009. 57(2): p. 313-21 [PMID:18801012] - Okazaki Y, et al.
A chloroplastic UDP-glucose pyrophosphorylase from Arabidopsis is the committed enzyme for the first step of sulfolipid biosynthesis. Plant Cell, 2009. 21(3): p. 892-909 [PMID:19286968] - Wawrzyńska A,Lewandowska M,Sirko A
Nicotiana tabacum EIL2 directly regulates expression of at least one tobacco gene induced by sulphur starvation. J. Exp. Bot., 2010. 61(3): p. 889-900 [PMID:20018902] - Lewandowska M, et al.
A contribution to identification of novel regulators of plant response to sulfur deficiency: characteristics of a tobacco gene UP9C, its protein product and the effects of UP9C silencing. Mol Plant, 2010. 3(2): p. 347-60 [PMID:20147370] - Garc
Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis. J. Exp. Bot., 2010. 61(14): p. 3885-99 [PMID:20627899] - Kawashima CG, et al.
Interplay of SLIM1 and miR395 in the regulation of sulfate assimilation in Arabidopsis. Plant J., 2011. 66(5): p. 863-76 [PMID:21401744] - Chan PK,Biswas B,Gresshoff PM
Classical ethylene insensitive mutants of the Arabidopsis EIN2 orthologue lack the expected 'hypernodulation' response in Lotus japonicus. J Integr Plant Biol, 2013. 55(4): p. 395-408 [PMID:23452324] - Luo J, et al.
A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2. J. Exp. Bot., 2013. 64(16): p. 5075-84 [PMID:24014864] - Frerigmann H,Gigolashvili T
Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] - Zheng ZL,Zhang B,Leustek T
Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing. Front Plant Sci, 2014. 5: p. 710 [PMID:25566284] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Panda SK,Sunkar R
Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling. Plant Signal Behav, 2015. 10(4): p. e1010916 [PMID:25912823] - Wawrzyńska A,Sirko A
EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor. Plant Sci., 2016. 253: p. 50-57 [PMID:27968996] - Chao Q, et al.
Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins. Cell, 1997. 89(7): p. 1133-44 [PMID:9215635] - Solano R,Stepanova A,Chao Q,Ecker JR
Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1. Genes Dev., 1998. 12(23): p. 3703-14 [PMID:9851977]
|