PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc02836.1.g00010.1.am.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 163aa MW: 17616.8 Da PI: 9.0036 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57 | 2.7e-18 | 80 | 113 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C++C+ +Tp+WR gp g+ktLCnaCG++y++ + Zpz_sc02836.1.g00010.1.am.mk 80 CTHCQIESTPQWRAGPLGPKTLCNACGVRYKSGR 113 *******************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 4.61E-15 | 73 | 136 | No hit | No description |
PROSITE profile | PS50114 | 11.543 | 74 | 110 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.0E-15 | 74 | 124 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 6.7E-15 | 78 | 111 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.40E-14 | 79 | 136 | No hit | No description |
Pfam | PF00320 | 6.8E-16 | 80 | 114 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 80 | 105 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
AVEPPTILVP TPMYSAASSH SDPESIAESN PDPAPPKKKK KAKKPAPAPA ASDAEGDADG 60 DADYVEGGER SWPQGAVRRC THCQIESTPQ WRAGPLGPKT LCNACGVRYK SGRLFPEYRP 120 AASPTFVPSI HSNSHKKVVE MRQKAVRSGD PSCDLLQFIR RRD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc02836.1.g00010.1.am.mk |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT054269 | 1e-157 | BT054269.1 Zea mays full-length cDNA clone ZM_BFb0206G24 mRNA, complete cds. | |||
GenBank | BT055755 | 1e-157 | BT055755.1 Zea mays full-length cDNA clone ZM_BFb0170C21 mRNA, complete cds. | |||
GenBank | BT067067 | 1e-157 | BT067067.1 Zea mays full-length cDNA clone ZM_BFb0175B18 mRNA, complete cds. | |||
GenBank | EU967675 | 1e-157 | EU967675.1 Zea mays clone 305252 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025807686.1 | 2e-89 | GATA transcription factor 8-like | ||||
Refseq | XP_025807694.1 | 2e-89 | GATA transcription factor 8-like | ||||
Swissprot | O82632 | 7e-37 | GATA9_ARATH; GATA transcription factor 9 | ||||
TrEMBL | A0A2T7FDI5 | 4e-88 | A0A2T7FDI5_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8KYD8 | 5e-88 | A0A2T8KYD8_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ab03246.1.p | 1e-87 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5169 | 34 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 7e-39 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|