PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G54810.2

Common Name

BME3, BME3-ZF, F28P10.210, GATA8, T5N23.3

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

GATA

Protein Properties

Length: 322aa MW: 35628.6 Da PI: 6.7104

Description

GATA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G54810.2	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GATA	56.5	3.9e-18	231	264	1	34
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C +C +tkTp+WR gp g+ktLCnaCG++y++ + AT3G54810.2 231 CMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGR 264 99*****************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF016992	2.8E-98	1	321	IPR016679	Transcription factor, GATA, plant
PROSITE profile	PS50114	11.569	225	261	IPR000679	Zinc finger, GATA-type
SMART	SM00401	7.8E-14	225	275	IPR000679	Zinc finger, GATA-type
SuperFamily	SSF57716	1.52E-14	229	288	No hit	No description
Gene3D	G3DSA:3.30.50.10	2.8E-14	229	262	IPR013088	Zinc finger, NHR/GATA-type
CDD	cd00202	9.38E-15	230	277	No hit	No description
PROSITE pattern	PS00344	0	231	256	IPR000679	Zinc finger, GATA-type
Pfam	PF00320	4.1E-16	231	264	IPR000679	Zinc finger, GATA-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007623	Biological Process	circadian rhythm
GO:0009845	Biological Process	seed germination
GO:0030154	Biological Process	cell differentiation
GO:0045944	Biological Process	positive regulation of transcription from RNA polymerase II promoter
GO:0005634	Cellular Component	nucleus
GO:0005667	Cellular Component	transcription factor complex
GO:0000977	Molecular Function	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085	Molecular Function	RNA polymerase II transcription factor binding
GO:0001228	Molecular Function	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682	Molecular Function	chromatin binding
GO:0008270	Molecular Function	zinc ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0009074	anatomy	style
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 322 aa Download sequence Send to blast
MIGTSFPEDL DCGNFFDNMD DLMDFPGGDI DVGFGIGDSD SFPTIWTTHH DTWPAASDPL 60 FSSNTNSDSS PELYVPFEDI VKVERPPSFV EETLVEKKED SFSTNTDSSS SHSQFRSSSP 120 VSVLESSSSS SQTTNTTSLV LPGKHGRPRT KRPRPPVQDK DRVKDNVCGG DSRLIIRIPK 180 QFLSDHNKMI NKKKKKKAKI TSSSSSSGID LEVNGNNVDS YSSEQYPLRK CMHCEVTKTP 240 QWRLGPMGPK TLCNACGVRY KSGRLFPEYR PAASPTFTPA LHSNSHKKVA EMRNKRCSDG 300 SYITEENDLQ GLIPNNAYIG VD

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	150	154	KRPRP

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.23953	0.0	flower\| leaf\| root\| seed\| vegetative tissue

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	251861_at	0.0
Expression Atlas	AT3G54810	-
AtGenExpress	AT3G54810	-
ATTED-II	AT3G54810	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a protein containing a GATA type zinc finger domain that is expressed in the embryo axis and involved in germination. Mutants have a reduced rate of germination even when stratified.
UniProt	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
Blue Micropylar End 3 (BME3) is activated specifically in the embryonic axis and shows potential involvement in GA biosynthesis suggesting its role in the regulation of seed germination. [BME3-ZF] [PMID: 16359389]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G54810.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G54810

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF412107	0.0	AF412107.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.
GenBank	AK317503	0.0	AK317503.1 Arabidopsis thaliana AT3G54810 mRNA, complete cds, clone: RAFL23-14-K23.
GenBank	AY078029	0.0	AY078029.1 Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191041.1	0.0	Plant-specific GATA-type zinc finger transcription factor family protein
Refseq	NP_850704.1	0.0	Plant-specific GATA-type zinc finger transcription factor family protein
Swissprot	Q9SV30	0.0	GATA8_ARATH; GATA transcription factor 8
TrEMBL	B9DHF1	0.0	B9DHF1_ARATH; GATA transcription factor
STRING	AT3G54810.1	0.0	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G54810.2
Entrez Gene	824646
iHOP	AT3G54810
wikigenes	AT3G54810

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gutierrez RA,Ewing RM,Cherry JM,Green PJ Identification of unstable transcripts in Arabidopsis by cDNA microarray analysis: rapid decay is associated with a group of touch- and specific clock-controlled genes. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(17): p. 11513-8 [PMID:12167669] Jeong MJ,Jeong MJ,Shih MC Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis. Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62 [PMID:12504119] Mittelsten Scheid O,Afsar K,Paszkowski J Formation of stable epialleles and their paramutation-like interaction in tetraploid Arabidopsis thaliana. Nat. Genet., 2003. 34(4): p. 450-4 [PMID:12847525] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Reyes JC,Muro-Pastor MI,Florencio FJ The GATA family of transcription factors in Arabidopsis and rice. Plant Physiol., 2004. 134(4): p. 1718-32 [PMID:15084732] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Lu Y,Zhu J,Liu P A two-step strategy for detecting differential gene expression in cDNA microarray data. Curr. Genet., 2005. 47(2): p. 121-31 [PMID:15688252] Bi YM, et al. Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity. Plant J., 2005. 44(4): p. 680-92 [PMID:16262716] Liu PP,Koizuka N,Martin RC,Nonogaki H The BME3 (Blue Micropylar End 3) GATA zinc finger transcription factor is a positive regulator of Arabidopsis seed germination. Plant J., 2005. 44(6): p. 960-71 [PMID:16359389] Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family. Plant Physiol., 2007. 143(2): p. 941-58 [PMID:17208962] Lee J, et al. Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] Sottosanto JB,Saranga Y,Blumwald E Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana. BMC Plant Biol., 2007. 7: p. 18 [PMID:17411438] Goeres DC, et al. Components of the Arabidopsis mRNA decapping complex are required for early seedling development. Plant Cell, 2007. 19(5): p. 1549-64 [PMID:17513503] Choi D, et al. iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis. Mol Plant, 2014. 7(5): p. 792-813 [PMID:24380880] Li T,Wu XY,Li H,Song JH,Liu JY A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network. Mol Plant, 2016. 9(5): p. 650-661 [PMID:26961720]