PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02786.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 162aa    MW: 17110.4 Da    PI: 7.781
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02786.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP102.38.3e-3248116573
                           TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                   ++++ ++h+kv gR+RRvR+++ +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Zpz_sc02786.1.g00040.1.sm.mk  48 RRTSADRHAKVAGRGRRVRIPVMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 116
                                   67889********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2651113IPR005333Transcription factor, TCP
PROSITE profilePS5136924.49351105IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MSSPSEIVLY NVVPTQTLNP APATAADLSV SASAPQPQQQ IPVRGRGRRT SADRHAKVAG  60
RGRRVRIPVM VAARVFQLTR ELGHRTDGET IEWLLRQAEP SIIAATGTGV TPEEAPPAAV  120
PVAGSAAAPY MPVPYYTSLL MQPPPVEESA ASASVTNAEE NH
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02786.1.g00040.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823176.13e-67transcription factor PCF1-like
SwissprotO238751e-56PCF1_ORYSJ; Transcription factor PCF1
TrEMBLA0A3L6Q5505e-67A0A3L6Q550_PANMI; Transcription factor PCF1-like
STRINGBRADI5G02880.19e-66(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.11e-29TCP family protein