PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc01086.1.g00090.1.sm.mk | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 117aa MW: 12747.4 Da PI: 10.0395 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 52.1 | 9.2e-17 | 29 | 63 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +C + kT +WR gp g+ktLCnaCG++y++ +l Zpz_sc01086.1.g00090.1.sm.mk 29 CPHCASEKTQQWRTGPLGPKTLCNACGVRYKSGRL 63 9******************************9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 1.8E-14 | 23 | 73 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 3.4E-12 | 27 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 10.106 | 27 | 59 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 5.7E-14 | 27 | 87 | No hit | No description |
CDD | cd00202 | 4.03E-10 | 28 | 75 | No hit | No description |
Pfam | PF00320 | 7.9E-15 | 29 | 63 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 29 | 54 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MMNLPAAPAP GGGGDDPNSR SEDGGVRRCP HCASEKTQQW RTGPLGPKTL CNACGVRYKS 60 GRLVPEYRPA ASPTFVLTQH SNSHRKVMEL RRQKELIHHR GTSSSASSSP FRDYGLC |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc01086.1.g00090.1.sm.mk |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008658338.1 | 2e-48 | GATA transcription factor 2 | ||||
Swissprot | O49741 | 8e-45 | GATA2_ARATH; GATA transcription factor 2 | ||||
TrEMBL | A0A1D6K8G2 | 4e-47 | A0A1D6K8G2_MAIZE; GATA transcription factor | ||||
STRING | GRMZM2G113098_P01 | 6e-48 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4621 | 29 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45050.1 | 7e-47 | GATA transcription factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|