PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zpz_sc00130.1.g00630.1.am.mk

Organism

Zoysia pacifica

Taxonomic ID

1070856

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

TCP

Protein Properties

Length: 117aa MW: 12249.7 Da PI: 8.9573

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zpz_sc00130.1.g00630.1.am.mk	genome	ZGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	109.3	5.8e-34	60	117	1	58
TCP 1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58 aa+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++tieWLlqqa+pa Zpz_sc00130.1.g00630.1.am.mk 60 AAPKRSSTKDRHTKVEGRGRRIRMPALCAARVFQLTRELGHKTDGETIEWLLQQAEPA 117 689*****************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.8E-28	66	117	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	27.226	67	117	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MDVAGDGGGG RRPNFPLQLL EKEEQPCSSS AAVGASAGGG NGNGSGAPCG PGDEVQVRKA 60 APKRSSTKDR HTKVEGRGRR IRMPALCAAR VFQLTRELGH KTDGETIEWL LQQAEPA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved the regulation of plant development. Together with TCP14, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in developing leaf blade and specific floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Involved in gynoecium and silique development. Modulates the development of the different tissues of the gynoecium through its participation in auxin and cytokinin responses. Modulates the expression of the cytokinin-responsive genes ARR7 and ARR15. May repress the expression of the auxin biosynthetic genes YUC1 and YUC4 (PubMed:26303297). Acts as negative regulator of anthocyanin accumulation under high light conditions. Modulates the expression of transcription factors involved in the induction of anthocyanin biosynthesis genes (PubMed:26574599). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). {ECO:0000269\|PubMed:21668538, ECO:0000269\|PubMed:22267487, ECO:0000269\|PubMed:24689742, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:25757472, ECO:0000269\|PubMed:26303297, ECO:0000269\|PubMed:26574599}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Zpz_sc00130.1.g00630.1.am.mk

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:21183706). Induced during seed imbibition (PubMed:25655823). Induced by cytokinin (PubMed:26303297). {ECO:0000269\|PubMed:21183706, ECO:0000269\|PubMed:25655823, ECO:0000269\|PubMed:26303297}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT084392	1e-101	BT084392.2 Zea mays full-length cDNA clone ZM_BFb0108G19 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025825808.1	1e-57	transcription factor TCP14-like
Swissprot	Q9C9L2	2e-38	TCP15_ARATH; Transcription factor TCP15
TrEMBL	A0A1E5UWR3	1e-56	A0A1E5UWR3_9POAL; Transcription factor TCP15
TrEMBL	A0A2S3GSV0	3e-56	A0A2S3GSV0_9POAL; Uncharacterized protein
TrEMBL	A0A2T7FBJ3	3e-56	A0A2T7FBJ3_9POAL; Uncharacterized protein
STRING	Pavir.J14065.1.p	4e-57	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3744	34	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69690.1	8e-37	TCP family protein

Publications ? help Back to Top
Steiner E, et al. The Putative O-Linked N-Acetylglucosamine Transferase SPINDLY Inhibits Class I TCP Proteolysis to Promote Sensitivity to Cytokinin. Plant Physiol., 2016. 171(2): p. 1485-94 [PMID:27208284] Dong H, et al. Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis. Genes Dev., 2017. 31(2): p. 197-208 [PMID:28167503] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Mazur MJ, et al. Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci. Front Plant Sci, 2017. 8: p. 2043 [PMID:29250092]