PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc05144.1.g00030.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

MIKC_MADS

Protein Properties

Length: 217aa MW: 24692.5 Da PI: 9.7497

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc05144.1.g00030.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.3	5.7e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s Zmw_sc05144.1.g00030.1.sm.mkhc 9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEFAS 59 79***********************************************86 PP
2	K-box	50.7	7.7e-18	78	162	6	90
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 ++++ +++ e+ + +++ L k++e L+ +R+llGe Le++s+ eL++Le +Leksl +R +K + l+e+ +l+k + Zmw_sc05144.1.g00030.1.sm.mkhc 78 TNNTVQQDIEQIKADAEGLAKKLEALEAYKRKLLGERLEECSIDELHSLEVKLEKSLHIVRGRKVRKLKEEEMTLRKNN 156 44467888999******************************************************************** PP K-box 85 kelqee 90 ++l+e+ Zmw_sc05144.1.g00030.1.sm.mkhc 157 EDLREK 162 *99986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.819	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.19E-33	3	84	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-31	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.08E-42	3	75	No hit	No description
Pfam	PF00319	1.7E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.8E-17	83	163	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	11.487	86	169	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000060	Biological Process	protein import into nucleus, translocation
GO:0009409	Biological Process	response to cold
GO:0009739	Biological Process	response to gibberellin
GO:0009838	Biological Process	abscission
GO:0009911	Biological Process	positive regulation of flower development
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010150	Biological Process	leaf senescence
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0080187	Biological Process	floral organ senescence
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008134	Molecular Function	transcription factor binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 217 aa Download sequence Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEFASA 60 SVQKTVERYR TYTKDNVTNN TVQQDIEQIK ADAEGLAKKL EALEAYKRKL LGERLEECSI 120 DELHSLEVKL EKSLHIVRGR KVRKLKEEEM TLRKNNEDLR EKCKVQPQLV APLGVVATQD 180 KHPEKAGNDM DVETELFIGL PGRDNRPSKA AIAVVEI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-19	1	72	1	72	MEF2C
5f28_B	1e-19	1	72	1	72	MEF2C
5f28_C	1e-19	1	72	1	72	MEF2C
5f28_D	1e-19	1	72	1	72	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00076	ChIP-chip	Transfer from AT2G45660	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004985919.1	1e-120	MADS-box transcription factor 50 isoform X2
Refseq	XP_004985920.1	1e-120	MADS-box transcription factor 50 isoform X2
Refseq	XP_012698462.1	1e-120	MADS-box transcription factor 50 isoform X2
Swissprot	Q9XJ60	1e-112	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	Q9FR85	1e-114	Q9FR85_MAIZE; M5 protein
STRING	GRMZM2G171365_P01	1e-114	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1413	33	79

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]