PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc01846.1.g00070.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 154aa MW: 17004 Da PI: 7.6174 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.8 | 1.3e-14 | 24 | 83 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +re+r+ +NRe+ArrsR+RK++ ++eL ++++ L+aeN + + ++ +++++++e+ Zmw_sc01846.1.g00070.1.am.mk 24 HRREKRRLSNRESARRSRLRKQQHLDELVQEAARLQAENARVAARAADFAAQYQRVEQEN 83 58****************************************************999998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.3E-10 | 20 | 80 | No hit | No description |
SMART | SM00338 | 4.5E-17 | 21 | 85 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.909 | 23 | 86 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.6E-11 | 24 | 83 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.26E-9 | 25 | 72 | No hit | No description |
CDD | cd14702 | 6.00E-13 | 26 | 59 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 28 | 43 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006971 | Biological Process | hypotonic response | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000693 | Biological Process | positive regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MSSSSLSPGG RVSGSDGDSA ADTHRREKRR LSNRESARRS RLRKQQHLDE LVQEAARLQA 60 ENARVAARAA DFAAQYQRVE QENTVLRARA AELGDRLRSV NEVLRVVEEF SGVAMDIQDE 120 LPVDDPLLRP WQLPCPAAAM PIGGATTAAH MLQY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 37 | 43 | RRSRLRK |
2 | 37 | 44 | RRSRLRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00419 | DAP | Transfer from AT3G62420 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025808697.1 | 1e-93 | ocs element-binding factor 1 | ||||
Swissprot | P24068 | 2e-89 | OCS1_MAIZE; Ocs element-binding factor 1 | ||||
TrEMBL | A0A2T7EHZ0 | 3e-93 | A0A2T7EHZ0_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6R976 | 3e-93 | A0A3L6R976_PANMI; Ocs element-binding factor 1 | ||||
STRING | Pavir.Cb00560.1.p | 5e-94 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|