PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G62420.1

Common Name

ATBZIP53, BZIP53, T12C14.120

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 146aa MW: 16805.1 Da PI: 5.0746

Description

basic region/leucine zipper motif 53

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G62420.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	41.2	3.6e-13	25	83	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NRe+ArrsR RK++++ L ++v L++ N + ++++e +k++ +++s++ AT3G62420.1 25 RKRKRMISNRESARRSRMRKQKQLGDLINEVTLLKNDNAKITEQVDEASKKYIEMESKN 83 6789***************************************************9998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.1E-15	21	85	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.645	23	86	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.01E-11	25	76	No hit	No description
Pfam	PF00170	8.5E-12	25	83	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	7.9E-11	25	76	No hit	No description
CDD	cd14702	2.53E-16	26	76	No hit	No description
PROSITE pattern	PS00036	0	28	43	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006971	Biological Process	hypotonic response
GO:0009267	Biological Process	cellular response to starvation
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:2000693	Biological Process	positive regulation of seed maturation
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0045735	Molecular Function	nutrient reservoir activity
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MGSLQMQTSP ESDNDPRYAT VTDERKRKRM ISNRESARRS RMRKQKQLGD LINEVTLLKN 60 DNAKITEQVD EASKKYIEME SKNNVLRAQA SELTDRLRSL NSVLEMVEEI SGQALDIPEI 120 PESMQNPWQM PCPMQPIRAS ADMFDC

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	24	45	RKRKRMISNRESARRSRMRKQK
2	37	44	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.48798	0.0	flower\| root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186511339	0.0
Genevisible	251237_at	0.0
Expression Atlas	AT3G62420	-
AtGenExpress	AT3G62420	-
ATTED-II	AT3G62420	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: In developing seeds, accumulates in embryo cotyledons during late maturation, from the torpedo to the green cotyledon stages. Also present in endosperm. {ECO:0000269\|PubMed:19531597}.
Uniprot	TISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269\|PubMed:19531597}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a group-S bZIP transcription factor. Forms heterodimers with group-C bZIP transcription factors. The heterodimers bind to the ACTCAT cis-element of proline dehydrogenase gene.
UniProt	Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:16810321, ECO:0000269\|PubMed:19531597, ECO:0000269\|PubMed:21278122, ECO:0000269\|PubMed:25108460}.

Function -- GeneRIF ? help Back to Top
Heterodimers containing bZIP53 participate in enhanceosome formation to produce a dramatic increase in seed maturation gene transcription. [PMID: 19531597] bZIP1 and bZIP53 expression is enhanced during dark-induced starvation. Heterodimerization with members of the partially redundant C/S1 bZIP factor network reprograms primary metabolism in the starvation response. [PMID: 21278122] Data show that the group S1 basic leucine zipper transcription factors bZIP1 and bZIP53 reprogram primary C- and N-metabolism. [PMID: 26276836]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00419	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G62420.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:16810321, ECO:0000269\|PubMed:21278122}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G30775(A), AT5G65165(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G02640, AT4G34590, AT5G24800, AT5G28770, AT1G13600, AT1G75390
IntAct	Search Q9LZP8

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Reduced seed maturation (MAT) genes expression (PubMed:19531597). Slight reduction in the dark-induced activation of POX1/PRODH1 transcript accumulation (PubMed:21278122). {ECO:0000269\|PubMed:19531597, ECO:0000269\|PubMed:21278122}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G62420

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF400620	0.0	AF400620.1 Arabidopsis thaliana transcription factor-like protein bZIP53 mRNA, complete cds.
GenBank	AL162507	0.0	AL162507.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T12C14.
GenBank	AY050923	0.0	AY050923.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBank	AY091421	0.0	AY091421.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191801.1	1e-104	basic region/leucine zipper motif 53
Swissprot	Q9LZP8	1e-105	BZP53_ARATH; bZIP transcription factor 53
TrEMBL	A0A178VDD2	1e-102	A0A178VDD2_ARATH; Uncharacterized protein
STRING	AT3G62420.1	1e-103	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3036	27	63
Representative plant	OGRP551	16	78

Link Out ? help Back to Top
Phytozome	AT3G62420.1
Entrez Gene	825415
iHOP	AT3G62420
wikigenes	AT3G62420

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Lara P, et al. Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. J. Biol. Chem., 2003. 278(23): p. 21003-11 [PMID:12657652] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Wiese A,Elzinga N,Wobbes B,Smeekens S A conserved upstream open reading frame mediates sucrose-induced repression of translation. Plant Cell, 2004. 16(7): p. 1717-29 [PMID:15208401] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Weltmeier F, et al. Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors. EMBO J., 2006. 25(13): p. 3133-43 [PMID:16810321] Filatov V, et al. Comparison of gene expression in segregating families identifies genes and genomic regions involved in a novel adaptation, zinc hyperaccumulation. Mol. Ecol., 2006. 15(10): p. 3045-59 [PMID:16911220] Baxter CJ, et al. The metabolic response of heterotrophic Arabidopsis cells to oxidative stress. Plant Physiol., 2007. 143(1): p. 312-25 [PMID:17122072] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Cheng C, et al. An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice. BMC Genomics, 2007. 8: p. 175 [PMID:17577400] Hayden CA,Jorgensen RA Identification of novel conserved peptide uORF homology groups in Arabidopsis and rice reveals ancient eukaryotic origin of select groups and preferential association with transcription factor-encoding genes. BMC Biol., 2007. 5: p. 32 [PMID:17663791] Usadel B, et al. Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes. Plant Physiol., 2008. 146(4): p. 1834-61 [PMID:18305208] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Roschzttardtz H, et al. A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis. Plant Physiol., 2009. 150(1): p. 84-95 [PMID:19261733] Alonso R, et al. A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation. Plant Cell, 2009. 21(6): p. 1747-61 [PMID:19531597] Dietrich K, et al. Heterodimers of the Arabidopsis transcription factors bZIP1 and bZIP53 reprogram amino acid metabolism during low energy stress. Plant Cell, 2011. 23(1): p. 381-95 [PMID:21278122] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Ji X, et al. A novel method to identify the DNA motifs recognized by a defined transcription factor. Plant Mol. Biol., 2014. 86(4-5): p. 367-80 [PMID:25108460] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Hartmann L, et al. Crosstalk between Two bZIP Signaling Pathways Orchestrates Salt-Induced Metabolic Reprogramming in Arabidopsis Roots. Plant Cell, 2015. 27(8): p. 2244-60 [PMID:26276836] Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment. Front Plant Sci, 2017. 8: p. 277 [PMID:28293251] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Jain P, et al. A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation. Sci Rep, 2017. 7(1): p. 14343 [PMID:29084982] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]