PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma161g00580.1 | ||||||||
Common Name | ZOSMA_161G00580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 192aa MW: 22212.4 Da PI: 11.0916 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57 | 4.5e-18 | 14 | 59 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ Zosma161g00580.1 14 RGHWRPREDEKLRQLVAQYGPQSWNSIAEKLQ-GRSGKSCRLRWFNQ 59 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 55.1 | 1.8e-17 | 66 | 108 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++T+eE+e+l++ + +G++ W++Iar ++ gRt++ +k++w+ Zosma161g00580.1 66 KKPFTEEEEEKLLKSHSVHGNR-WALIARLFP-GRTDNAVKNHWH 108 689*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.967 | 9 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.27E-29 | 13 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-14 | 13 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-17 | 14 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-27 | 15 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.67E-13 | 17 | 58 | No hit | No description |
PROSITE profile | PS51294 | 24.872 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-15 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.0E-15 | 66 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.6E-22 | 68 | 114 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MEDSGATPAR MCPRGHWRPR EDEKLRQLVA QYGPQSWNSI AEKLQGRSGK SCRLRWFNQL 60 DPRINKKPFT EEEEEKLLKS HSVHGNRWAL IARLFPGRTD NAVKNHWHVI TARKQRQRAR 120 SFDPRLKFNY GYKPMPKSSS SRLSWAVSSI LINRKPLLSP KSTPFRRSFP DKDDTKEVPY 180 IDFLGVGLPS T* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-33 | 14 | 114 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020252127.1 | 6e-71 | transcription factor MYB52-like | ||||
Swissprot | Q6R0C4 | 2e-62 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A0K9PWN4 | 1e-139 | A0A0K9PWN4_ZOSMR; Uncharacterized protein | ||||
STRING | XP_006473036.1 | 2e-66 | (Citrus sinensis) | ||||
STRING | XP_006434346.1 | 2e-66 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP294 | 38 | 260 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 3e-58 | myb domain protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma161g00580.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|