PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G17950.1

Common Name

ATMYB52, BW52, MYB52

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 249aa MW: 28925.5 Da PI: 9.0288

Description

myb domain protein 52

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G17950.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.3	7.3e-18	5	50	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G+++W++Ia+++ gR++k+c++rw++ AT1G17950.1 5 RGHWRPAEDEKLRELVEQFGPHNWNAIAQKLS-GRSGKSCRLRWFNQ 50 899***************************.*********996 PP
2	Myb_DNA-binding	55.5	1.3e-17	57	100	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ ++ +G++ W+ Iar ++ gRt++ +k++w+ AT1G17950.1 57 RNPFTEEEEERLLASHRIHGNR-WSVIARFFP-GRTDNAVKNHWHV 100 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.039	1	55	IPR017930	Myb domain
SMART	SM00717	9.3E-15	4	53	IPR001005	SANT/Myb domain
Pfam	PF00249	7.7E-17	5	50	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.12E-30	5	98	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.8E-27	6	58	IPR009057	Homeodomain-like
CDD	cd00167	1.75E-13	8	49	No hit	No description
PROSITE profile	PS51294	18.713	56	106	IPR017930	Myb domain
SMART	SM00717	1.3E-15	56	104	IPR001005	SANT/Myb domain
Pfam	PF00249	1.8E-14	57	99	IPR001005	SANT/Myb domain
CDD	cd00167	4.09E-12	59	99	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.0E-21	59	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009737	Biological Process	response to abscisic acid
GO:0030154	Biological Process	cell differentiation
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000230	anatomy	inflorescence meristem
PO:0000272	anatomy	protoxylem
PO:0005352	anatomy	xylem
PO:0005848	anatomy	secondary xylem
PO:0009005	anatomy	root
PO:0009029	anatomy	stamen
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0025022	anatomy	collective leaf structure
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MMCSRGHWRP AEDEKLRELV EQFGPHNWNA IAQKLSGRSG KSCRLRWFNQ LDPRINRNPF 60 TEEEEERLLA SHRIHGNRWS VIARFFPGRT DNAVKNHWHV IMARRGRERS KLRPRGLGHD 120 GTVAATGMIG NYKDCDKERR LATTTAINFP YQFSHINHFQ VLKEFLTGKI GFRNSTTPIQ 180 EGAIDQTKRP MEFYNFLQVN TDSKIHELID NSRKDEEEDV DQNNRIPNEN CVPFFDFLSV 240 GNSASQGLC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-31	5	105	7	107	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30685609	0.0
Genevisible	255903_at	0.0
Expression Atlas	AT1G17950	-
AtGenExpress	AT1G17950	-
ATTED-II	AT1G17950	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
TAIR	putative transcription factor: R2R3-MYB transcription family
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Function -- GeneRIF ? help Back to Top
Decreased methylesterification in the myb52 mutant is correlated with an increase in the calcium content of the seed mucilage. [PMID: 29440562]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G17950.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G32770 (A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G17950

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519554	0.0	AY519554.1 Arabidopsis thaliana MYB transcription factor (At1g17950) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_173237.1	0.0	myb domain protein 52
Swissprot	Q6R0C4	0.0	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A178WDN0	0.0	A0A178WDN0_ARATH; MYB52
STRING	AT1G17950.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2818	27	69
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G17950.1
Entrez Gene	838374
iHOP	AT1G17950
wikigenes	AT1G17950

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl. Plant Physiol., 2005. 138(2): p. 803-18 [PMID:15923329] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Andersson-Gunner Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis. Plant J., 2006. 45(2): p. 144-65 [PMID:16367961] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Ko JH,Beers EP,Han KH Global comparative transcriptome analysis identifies gene network regulating secondary xylem development in Arabidopsis thaliana. Mol. Genet. Genomics, 2006. 276(6): p. 517-31 [PMID:16969662] Ko JH,Yang SH,Park AH,Lerouxel O,Han KH ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana. Plant J., 2007. 50(6): p. 1035-48 [PMID:17565617] Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2763-82 [PMID:18952777] Cheng H, et al. Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis. PLoS Genet., 2009. 5(3): p. e1000440 [PMID:19325888] Ko JH,Kim WC,Han KH Ectopic expression of MYB46 identifies transcriptional regulatory genes involved in secondary wall biosynthesis in Arabidopsis. Plant J., 2009. 60(4): p. 649-65 [PMID:19674407] Park MY,Kang JY,Kim SY Overexpression of AtMYB52 confers ABA hypersensitivity and drought tolerance. Mol. Cells, 2011. 31(5): p. 447-54 [PMID:21399993] Zhong R,Ye ZH MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol., 2012. 53(2): p. 368-80 [PMID:22197883] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]