| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | WRKY | 108.8 | 2.6e-34 | 7 | 65 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d+++v++tYeg+Hnh+
GRMZM2G449681_P03 7 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDKRAVITTYEGKHNHD 65
59********************************************************7 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0006813 | Biological Process | potassium ion transport |
| GO:0009409 | Biological Process | response to cold |
| GO:0009414 | Biological Process | response to water deprivation |
| GO:0009651 | Biological Process | response to salt stress |
| GO:0010120 | Biological Process | camalexin biosynthetic process |
| GO:0010200 | Biological Process | response to chitin |
| GO:0010508 | Biological Process | positive regulation of autophagy |
| GO:0042742 | Biological Process | defense response to bacterium |
| GO:0050832 | Biological Process | defense response to fungus |
| GO:0070370 | Biological Process | cellular heat acclimation |
| GO:0005634 | Cellular Component | nucleus |
| GO:0016021 | Cellular Component | integral component of membrane |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0005249 | Molecular Function | voltage-gated potassium channel activity |
| GO:0030955 | Molecular Function | potassium ion binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
| Publications
? help Back to Top |
- Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
Plant Methods, 2010. 6: p. 25
[PMID:21108821] - Brand LH, et al.
Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
PLoS ONE, 2013. 8(10): p. e75177
[PMID:24146751] - Ali MA,Wieczorek K,Kreil DP,Bohlmann H
The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots.
PLoS ONE, 2014. 9(7): p. e102360
[PMID:25033038] - Divi UK,Rahman T,Krishna P
Gene expression and functional analyses in brassinosteroid-mediated stress tolerance.
Plant Biotechnol. J., 2016. 14(1): p. 419-32
[PMID:25973891] - Peskan-Berghöfer T, et al.
Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
New Phytol., 2015. 208(3): p. 873-86
[PMID:26075497] - Wang C, et al.
The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum.
Plant Physiol., 2015. 169(1): p. 856-72
[PMID:26143252] - Wang C, et al.
Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola.
Plant J., 2015. 83(6): p. 1019-33
[PMID:26216741] - Datta R, et al.
Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress.
Plant Physiol., 2015. 169(4): p. 2963-81
[PMID:26463088] - Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea.
Front Plant Sci, 2015. 6: p. 1158
[PMID:26779190] - Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance.
Front Plant Sci, 2016. 7: p. 227
[PMID:26973671] - Jiang Y,Yu D
The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
Plant Physiol., 2016. 171(4): p. 2771-82
[PMID:27268959] - Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
Plant Cell, 2016. 28(7): p. 1662-81
[PMID:27317674] - Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity.
Plant Cell, 2017. 29(1): p. 20-38
[PMID:28011690] - Nguyen CC, et al.
Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity.
Plant Signal Behav, 2017. 12(2): p. e1282591
[PMID:28112571] - Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity.
Plant Cell Environ., 2017. 40(10): p. 2189-2206
[PMID:28708934] - D'Ambrosio JM, et al.
Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production.
Plant Physiol., 2017. 175(2): p. 970-981
[PMID:28827453] - Liu F, et al.
Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection.
Plant Biotechnol. J., 2018. 16(4): p. 911-925
[PMID:28929638] - Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea.
Plant Cell Rep., 2018. 37(1): p. 153-166
[PMID:29119291]
|
