PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G156016_P01
Common NameLOC100280171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 543aa    MW: 60628.7 Da    PI: 4.8945
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G156016_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ414.32.2e-1272454612217
                VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwna 92 
                        +psafl+pkcalwdc+rpa gse+++dycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip cegaatakspwna
  GRMZM2G156016_P01 245 APSAFLKPKCALWDCPRPAVGSERWHDYCSMYHADLAVQEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKNVGIPICEGAATAKSPWNA 336
                        69************************************9879************************************************** PP

                VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyr 184
                        +elfdl ++ege+irewlffdkprraf sgnrkqrslpdy grgwhesrkq mk+fgglkrsyymdpqps+s+ewhlyeyeine+da+alyr
  GRMZM2G156016_P01 337 PELFDLYIFEGESIREWLFFDKPRRAFVSGNRKQRSLPDYGGRGWHESRKQAMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINECDAFALYR 428
                        ******************************************************************************************** PP

                VOZ 185 lelklvdekksakgkvskdsladlqkklgrlta 217
                        le+k++d+kk +k+k+++++l+++q++++rl+a
  GRMZM2G156016_P01 429 LEFKSSDAKKIVKSKLACNPLNEIQQQMVRLSA 461
                        *******************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MGKVPSSRAG SRHQQFRARA MTRVDDLQEV FSGLQSARKD SRPTDAAILE AQLQQMLREW  60
RSELSAPSPA SSLQGNAREL SDPPSDTLRM LQLAAAEEED DATSKMVEQQ QQPPPPANQN  120
QGHAQVCQDM KREPREEAVD VAVEKPQPLS QGVLLNGAAT ASAVFHDQEL TVEDFLYDDD  180
YKIDLSGSNL DVLNNLEGIV QLEYPQLNLP QELAPNVYID MSYCGQNAGG VLLHMTDLFT  240
TMTSAPSAFL KPKCALWDCP RPAVGSERWH DYCSMYHADL AVQEEGPPGT MPVIRPRGID  300
LKDGPLFAAL SAKIQGKNVG IPICEGAATA KSPWNAPELF DLYIFEGESI REWLFFDKPR  360
RAFVSGNRKQ RSLPDYGGRG WHESRKQAMK DFGGLKRSYY MDPQPSNSYE WHLYEYEINE  420
CDAFALYRLE FKSSDAKKIV KSKLACNPLN EIQQQMVRLS ADSPVDNKRT ARGRQHANPT  480
DVDTNIYSVP NTTAQANVPN AYQPGSQVDQ MTYLNGSVVY GPHLPYGYST ERSDFYWNSA  540
DGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.270970.0leaf| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G156016
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G156016_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0671960.0BT067196.1 Zea mays full-length cDNA clone ZM_BFb0282C22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146575.10.0Transcription factor VOZ1
SwissprotQ9SGQ01e-149VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB8A2B30.0B8A2B3_MAIZE; Transcription factor VOZ1
TrEMBLK4JCB50.0K4JCB5_MAIZE; VOZ-type transcription factor (Fragment)
STRINGGRMZM2G156016_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-140vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]