PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G28520.2
Common NameATVOZ1, F1K23.24, F3M18.4, VOZ1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family VOZ
Protein Properties Length: 486aa    MW: 54079.7 Da    PI: 5.8961
Description vascular plant one zinc finger protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G28520.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaflgpkcalwdc+rpaqg++w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfaalsak+ gk+vgipecegaatakspwna+elfdl
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                  ++le+et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kk++
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrlta 217
                  *******************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009585Biological Processred, far-red light phototransduction
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.408730.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT1G28520-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Function -- GeneRIF ? help Back to Top
  1. VOZ1 and VOZ2 function in the vascular bundle to regulate flowering.
    [PMID: 22904146]
  2. Vascular plant one-zinc-finger proteins (VOZs) function as both negative and positive regulators of the abiotic and biotic stress-responsive pathways, and control Arabidopsis adaptation to various stress conditions.
    [PMID: 23167462]
  3. Data suggest that VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 modulate CONSTANS (CO) function to promote flowering.
    [PMID: 29507119]
  4. These results demonstrate that VOZ1 functions as a negative regulator of heat stress (HS)-inducible DREB2C signaling by blocking access to the AP2 DNA-binding domain of DREB2C.
    [PMID: 29536220]
Cis-element ? help Back to Top
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SGQ0
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Voz1 and voz2 double mutant displays a late flowering phenotype under long-day conditions. {ECO:0000269|PubMed:22904146}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G28520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252560.0AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAK2270140.0AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
GenBankBT0202610.0BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077618.10.0vascular plant one zinc finger protein
RefseqNP_001319100.10.0vascular plant one zinc finger protein
RefseqNP_001321335.10.0vascular plant one zinc finger protein
RefseqNP_174174.10.0vascular plant one zinc finger protein
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
STRINGAT1G28520.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Mitsuda N,Hisabori T,Takeyasu K,Sato MH
    VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(7): p. 845-54
  2. Laubinger S, et al.
    Dual roles of the nuclear cap-binding complex and SERRATE in pre-mRNA splicing and microRNA processing in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(25): p. 8795-800
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
  4. Jensen MK, et al.
    The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.
    Biochem. J., 2010. 426(2): p. 183-96
  5. Min BE, et al.
    A host-factor interaction and localization map for a plant-adapted rhabdovirus implicates cytoplasm-tethered transcription activators in cell-to-cell movement.
    Mol. Plant Microbe Interact., 2010. 23(11): p. 1420-32
  6. Mimida N, et al.
    Apple FLOWERING LOCUS T proteins interact with transcription factors implicated in cell growth and organ development.
    Tree Physiol., 2011. 31(5): p. 555-66
  7. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
  8. Yasui Y, et al.
    The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.
    Plant Cell, 2012. 24(8): p. 3248-63
  9. Nakai Y, et al.
    Vascular plant one-zinc-finger protein 1/2 transcription factors regulate abiotic and biotic stress responses in Arabidopsis.
    Plant J., 2013. 73(5): p. 761-75
  10. Nakai Y,Fujiwara S,Kubo Y,Sato MH
    Overexpression of VOZ2 confers biotic stress tolerance but decreases abiotic stress resistance in Arabidopsis.
    Plant Signal Behav, 2013. 8(3): p. e23358
  11. Celesnik H,Ali GS,Robison FM,Reddy AS
    Arabidopsis thaliana VOZ (Vascular plant One-Zinc finger) transcription factors are required for proper regulation of flowering time.
    Biol Open, 2013. 2(4): p. 424-31
  12. Hwang SM, et al.
    Functional characterization of Arabidopsis HsfA6a as a heat-shock transcription factor under high salinity and dehydration conditions.
    Plant Cell Environ., 2014. 37(5): p. 1202-22
  13. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
  14. Yang X, et al.
    Homodimerization of HYL1 ensures the correct selection of cleavage sites in primary miRNA.
    Nucleic Acids Res., 2014. 42(19): p. 12224-36
  15. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
  16. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
  17. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448